🏪

Retail

252 merchants ¡ 965 statement variations

Retail store charges, department store transactions, and shopping purchases on your bank statement. Identify mystery retail charges and discover what stores charged you.

About Retail charges

Retail charges cover a wide range of shopping transactions from department stores, specialty retailers, and general merchandise stores.

Retail merchant names typically include the store brand and may be followed by a location code. Large retailers often have consistent naming conventions across all their stores.

Online retail purchases may appear differently from in-store transactions, sometimes showing the e-commerce platform name instead.

Retail merchants (252)

2E Trading Pty Ltd

Likely a small Australian proprietary company using the name 2E Trading Pty Ltd, operating as a local trading or retail business, with card processing registered under this legal entity rather than a consumer-facing brand. Public information about its specific line of business is not available.

Cairns, Queensland, Australia (inferred from card descriptor; not confirmed by public records)

7-Eleven

7-Eleven is a global chain of convenience stores offering snacks, beverages, basic groceries, prepared foods, and often fuel, operating 24/7 in many locations.

Irving, Texas, United States7-eleven.com

99 Bikes

99 Bikes is an Australian bicycle and accessories retailer selling bikes, parts, accessories, and servicing through physical stores and an online shop.

Brisbane, Queensland, Australia99bikes.com.au

A C Cleaning Supplies Pty Ltd

A C Cleaning Supplies Pty Ltd is an Australian supplier of commercial and industrial cleaning products, equipment, and packaging materials serving businesses and cleaning professionals.

Kingsgrove, New South Wales, Australiaaccleaning.com.au

AGC Catering Equipment

AGC Catering Equipment is a family-owned Australian retailer and wholesaler supplying new and pre-owned commercial catering and hospitality equipment, kitchenware, crockery, cutlery and glassware to restaurants, cafĂŠs, hotels and other venues.

Greenacre, New South Wales, Australiaagcequipment.com.au

Action Aluminium

Action Aluminium is a family-owned Australian aluminium distribution company that supplies a wide range of aluminium products and cut-to-size services to trade and retail customers through multiple branches across Victoria, New South Wales, and Queensland.

Dandenong South, Victoria, Australiaactionaluminium.com.au

Agatha

Agatha is a French fashion jewelry brand offering affordable, stylish costume jewelry and accessories through its Agatha Paris boutiques and online store.

Paris, Franceagatha.fr

Alliance Safety Equipment

Alliance Safety Equipment is a family-owned Australian supplier of industrial safety products, providing sales, hire, and servicing of confined space and gas detection equipment, height safety and rescue gear, lockout/tagout systems, and personal protective equipment (PPE) for workplaces in North and North West Queensland.

Hyde Park, Townsville, Queensland, Australiaalliancesafety.com.au

Amato's Liquor Mart

Amato's Liquor Mart is an independent liquor store in Leichhardt, Sydney, offering a wide selection of Italian and international wines, beers, spirits, liqueurs and gourmet foods.

Leichhardt, New South Wales, Australiaamatos.com.au

Anaconda

Anaconda is an Australian retail chain specializing in outdoor adventure, camping, fishing, hiking, and sporting goods equipment and apparel.

Melbourne, Victoria, Australiaanacondastores.com

Assist Workplace Safety

Assist Workplace Safety is an Australian company based in Carlton, New South Wales that supplies workplace safety products and personal protective equipment, trading locally as Accidental Health & Safety – Sydney South.

Carlton, New South Wales, Australiaassistworkplacesafety.biz

Australian Way

Australian Way is an airport retail chain specializing in Australian-made souvenirs, gifts, apparel and travel essentials, operating in domestic and international terminals across major Australian airports. It is part of Lagardère AWPL, a leading travel retail operator in the Pacific region.

Melbourne, Victoria, Australiaawpl.com.au

Ayda Pty Ltd

Ayda Pty Ltd is an Australian private company based in Melbourne that operates convenience retail outlets, trading under franchised brands such as 7‑Eleven St Kilda Barkly Street and previously IGA Express Collins.

Melbourne, Victoria, Australia

BCF

BCF (Boating Camping Fishing) is an Australian retail chain specializing in outdoor leisure products, including boating, camping, fishing gear, and related accessories.

Strathpine, Queensland, Australiabcf.com.au

BCF - Boating, Camping, Fishing

BCF is an Australian retail chain specializing in boating, camping, fishing, and general outdoor and recreational gear and accessories.

Strathpine, Queensland, Australiabcf.com.au

BD Vending

BD Vending is an Australian company that supplies, installs, and services vending machines offering snacks, drinks, and healthier options for workplaces and organisations across Melbourne and surrounding areas.

Rowville, Victoria, Australiabdvending.com.au

BWS

BWS (Beer, Wine & Spirits) is an Australian chain of liquor stores offering a wide range of beer, wine, spirits, and related products through both physical bottle shops and online ordering.

Bella Vista, New South Wales, Australiabws.com.au

Baby Bunting

Baby Bunting is an Australian specialty retailer of baby and toddler products, including prams, car seats, nursery furniture, clothing, and accessories.

Dandenong South, Victoria, Australiababybunting.com.au

Badge World

Badge World is an Australian-owned specialist supplier of custom name badges, button badges, reusable badges and small printed signs, serving businesses, government, education and events nationwide via online ordering.

Rosebery, New South Wales, Australiabadgeworld.com.au

Becsul Pty Ltd

Becsul Pty Ltd is an Australian private company based in Tasmania that trades under beauty-supply brands such as Tasbeauty, Tasmanian Beauty Supplies, Ausbeauty and Australian Beauty Supplies, selling professional beauty, nail, waxing and salon products. The merchant descriptor in North Hobart likely reflects purchases from their Tasbeauty/Tasmanian Beauty Supplies operation.

Hobart, Tasmania, Australiatasbeauty.com.au

Belflora Flower Market

Belflora Flower Market is a large independent florist in Newcastle, Australia, offering fresh cut flowers, native flowers, and bespoke bouquets with same‑day delivery across the Hunter region.

Broadmeadow, New South Wales, Australiabelflora.com.au

Best Price Variety

Best Price Variety is an Australian-owned discount variety chain offering low-priced homewares, party supplies, crafts, toys, souvenirs, seasonal items and other general merchandise, with stores across the Perth region including Westfield Whitford City in Hillarys.

Perth, Western Australia, Australiabestpricevariety.com.au

Big W

Big W is an Australian chain of discount department stores offering clothing, homewares, electronics, toys, and general merchandise at value prices in-store and online.

Bella Vista, New South Wales, Australiabigw.com.au

BioPak

BioPak is an Australian company that designs and supplies compostable and environmentally friendly foodservice packaging products such as cups, containers, and cutlery to businesses and organizations.

Alexandria, New South Wales, Australiabiopak.com

Birka Design

Birka Design is a Melbourne-based studio creating unique, handmade jewellery—often using lampwork glass, silver, gold and natural stones—and offering related interior design pieces and artwork.

Melbourne, VIC, Australiabirka.com.au

Blackhearts & Sparrows

Blackhearts & Sparrows is an independent Australian wine and bottle shop chain specializing in curated wines, craft beer, and spirits from local and international producers.

Melbourne, VIC, Australiablackheartsandsparrows.com.au

Blue Mountains Camping & Hardware

Independent outdoor, camping, hardware and homewares store serving Katoomba and the Blue Mountains region, offering camping gear, gas fittings, gardening supplies, kitchenware and general hardware products.

Katoomba, New South Wales, Australiabluemountainscamping.com.au

Bolt & Nut

Bolt & Nut Australia is an Australian-owned fastener supplier and online retailer offering a wide range of bolts, nuts, screws, washers and related hardware for industrial, trade and DIY customers.

Murarrie, Brisbane, Queensland, Australiaboltandnut.com.au

Bolt Barn Lismore

Bolt Barn Lismore is an independent hardware and industrial fasteners retailer supplying bolts, screws, chains, tools, and related trade equipment to industrial, farming, and DIY customers in the Northern Rivers region of New South Wales, Australia.

South Lismore, New South Wales, Australiaboltbarn.com.au

BoozeBud

BoozeBud is an Australian online alcohol retailer that sells and delivers beer, wine, spirits, and other beverages directly to consumers.

Sydney, Australiaboozebud.com

Broadbeach Oasis News

Broadbeach Oasis News is a local newsagency located inside The Oasis Shopping Centre in Broadbeach, selling lottery tickets, greeting cards, stationery, newspapers and magazines.

Broadbeach, Queensland, Australiaoasisshoppingcentre.com.au

Brownes Dairy

Brownes Dairy is Western Australia’s oldest and one of its largest dairy companies, producing milk, yoghurt, cheese, cream and other dairy products for domestic and export markets.

Balcatta, Western Australia, Australiabrownesdairy.com.au

Brunswick St News & Lotto

Local newsagent and lottery outlet selling newspapers, magazines, stationery, and Lucky Day Lotto tickets on Brunswick Street in Fitzroy, Victoria.

Fitzroy, Victoria, Australia

Burgundy Liquor Pty Ltd

Independent bottle shop and liquor store retailing wine, beer, spirits and other alcoholic beverages to local customers in Southbank, Victoria.

8 Dorcas Street, Southbank, VIC 3006, Australia

C-Curry Pty Ltd

C‑Curry Pty Ltd is a small Australian proprietary company based in Queensland, likely operating as a local retail or general store business (formerly trading as Gardentown Store Pty Ltd).

Cloncurry, Queensland 4824, Australia

Cacau Show

Cacau Show is a large Brazilian chocolate and confectionery retailer and manufacturer, operating thousands of franchise shops that sell chocolates, truffles, gifts, and sweets. Charges labeled as “ASSB COMERCIO VAREJISTA DE DOCES LTDA” typically correspond to purchases made at Cacau Show–branded stores.

Itapevi, SĂŁo Paulo, Brazilcacaushow.com.br

Castletown

Castletown is a sub-regional shopping centre in Townsville featuring major retailers such as Coles, Woolworths and BIG W alongside over 100 specialty stores, dining options and services.

Brisbane, Queensland, Australiacastletown.com.au

Cellarbrations at The Abbey

Independent liquor store and cider lounge trading under the Cellarbrations banner, offering a wide range of beer, cider, wine and spirits at The Abbey venue in Sandy Bay, Tasmania.

Macquarie Park, New South Wales, Australiacellarbrations.com.au

Central Cleaning Supplies

Central Cleaning Supplies is an Australian-owned distributor and retailer of professional cleaning materials, chemicals, paper products and equipment, supplying commercial, industrial and domestic cleaning industries nationwide.

West Footscray, Victoria, Australiacentralcleaning.com.au

Charlie's Fine Food Co

Charlie's Fine Food Co is an Australian-owned producer and retailer of gourmet cookies, biscuits, and snack foods, supplying both foodservice customers and major supermarkets as well as selling direct-to-consumer online.

Bentleigh East, Victoria, Australiacharliesfinefoodco.com

Cheap as Chips

Cheap as Chips is an Australian discount variety retailer selling low-cost homewares, cleaning products, party supplies, seasonal goods, and general merchandise.

Adelaide, South Australia, Australiacheapaschips.com.au

Chef's Hat

Chef’s Hat is a hospitality and kitchenware retailer in South Melbourne, Australia, supplying professional chefs and home cooks with cookware, utensils, uniforms, and commercial kitchen equipment.

South Melbourne, Victoria, Australiachefshat.com.au

Choice The Discount Store

Choice The Discount Store is an Australian discount variety retailer offering low-priced household goods, party supplies, craft items, seasonal products, and everyday essentials through a chain of stores across Queensland and northern New South Wales.

Upper Coomera, Queensland, Australiachoicethediscountstore.com.au

Complete Office Supplies

Complete Office Supplies (COS) is an Australian-owned company that supplies office products, furniture, technology, and business consumables to corporate, government, and small business customers.

Lidcombe, New South Wales, Australiacos.net.au

Coraki Rural & Hardware Supplies

Coraki Rural & Hardware Supplies is a locally owned general and hardware store in Coraki, New South Wales, offering fuel, hardware, stockfeed, rural supplies, and convenience items to the local community.

Coraki, New South Wales, Australia

Costco Wholesale

Costco Wholesale is a membership-based warehouse club chain that sells a wide range of products including groceries, electronics, household goods, and apparel, often in bulk at discounted prices.

Issaquah, WAcostco.com

Cross Country Ski Hire Marysville

Cross Country Ski Hire Marysville is a locally owned ski and snow-gear hire shop providing clothing, cross-country skis, toboggans, snow chains and related equipment for visitors to nearby Lake Mountain Alpine Resort.

Marysville, Victoria, Australiacrosscountryskihire.com.au

Crystalwhite Cleaning Supplies

Crystalwhite Cleaning Supplies is an Australian cleaning products retailer and wholesaler based in Melbourne, supplying commercial and household cleaning chemicals, paper goods, and equipment both in-store and online.

Coburg, Victoria, Australiacrystalwhite.com.au

DICK'S Sporting Goods

DICK'S Sporting Goods is a major U.S. retail chain specializing in sporting goods, athletic apparel, footwear, and outdoor recreation equipment.

Coraopolis, Pennsylvania, USAdickssportinggoods.com

Daily Blooms

Daily Blooms is an Australian online florist that offers fresh, seasonal flower bouquets and curated gifts with same-day delivery across major cities including Melbourne, Sydney, Brisbane, and Perth.

Kennington, Victoria, Australiadailyblooms.com.au

Daiso

Daiso is a Japanese value-focused variety store chain known for selling a wide range of household goods, stationery, cosmetics, snacks, and seasonal items, typically at low fixed price points.

Higashihiroshima, Hiroshima, Japandaiso-sangyo.co.jp

Dan Murphy's

Dan Murphy's is a major Australian liquor retail chain offering a wide range of wine, beer, spirits, and other alcoholic beverages through large-format stores and online ordering.

Richmond, Victoria, Australiadanmurphys.com.au

David Jones

David Jones is a premium Australian department store chain offering fashion, beauty, homewares, and food products.

Sydney, New South Wales, Australiadavidjones.com

Deals

Deals was a U.S. discount variety store chain owned by Dollar Tree, offering low-priced everyday goods across multiple categories. Most Deals locations have since been rebranded as Dollar Tree or Family Dollar stores.

Chesapeake, VA, USAdollartree.com

Delta City

Delta City is a large modern shopping mall in Belgrade offering a wide range of international and local retail stores, restaurants, cafés, and entertainment including a multiplex cinema and children’s play areas.

Belgrade, Serbiadeltacity.rs

Display Decorations

Display Decorations is an Australian supplier, manufacturer, and importer of point‑of‑sale display products and retail fixtures, offering items such as brochure holders, signage, acrylic and custom retail displays for stores and events.

Knoxfield, Victoria, Australiadisplaydecorations.com.au

Dollarama

Dollarama is a Canadian chain of dollar stores offering low-cost household goods, party supplies, food, and everyday items.

Montreal, Quebec, Canadadollarama.com

Donner Music

Donner Music is a global music technology brand that designs, manufactures, and sells musical instruments, audio equipment, and related accessories, as well as offering a companion learning app and online music education content.

Guangzhou, Chinadonnermusic.com

Doree Embroidery

Doree Embroidery is a Brisbane-based embroidery and screen-printing company that provides custom embellishment services for uniforms, workwear, hats, and promotional apparel to businesses, organisations, and individuals.

Brisbane, Queensland, Australiadoree.com.au

Dymocks

Dymocks is an Australian bookseller chain that operates retail bookstores and an online store selling books, stationery, gifts, and related products.

Sydney, Australiadymocks.com.au

EB Games

EB Games is a specialty video game and electronics retailer selling new and pre-owned video games, consoles, accessories, and related merchandise.

Brisbane, Queensland, Australiaebgames.com.au

EE Hobbies

EE Hobbies Australia is an Australian retailer specializing in aerial photography and hobby products such as DJI drones and related equipment.

Croydon, Victoria, Australiaeehobbies.com.au

Easy Signs

Easy Signs is an Australian online signage and large-format printing company that produces custom signs, banners, decals, and display products for businesses and events.

Sydney, New South Wales, Australiaeasysigns.com.au

Eckersley's Art & Craft

Eckersley's Art & Craft is an Australian retailer specializing in art, craft, and design supplies for hobbyists, students, and professional artists.

Sydney, NSW, Australiaeckersleys.com.au

Economy Warehouse

Economy Warehouse is an independent Tasmanian retailer and wholesaler of home furniture, dĂŠcor, artificial plants and related home and garden accessories, operating from its Mornington showroom and serving the greater Hobart area.

Howrah, Tasmania, Australiaeconomywarehouse.com.au

EnviroShop

EnviroShop is an Australian retailer and service provider specialising in environmentally friendly products and sustainable living solutions, including energy‑efficient household goods and solar, battery and hot water systems.

Coburg North, Victoria, Australiaenviroshop.com.au

EzyMart

EzyMart is an Australian convenience store chain offering snacks, beverages, basic groceries, and everyday essentials, primarily in urban and high-foot-traffic locations.

Sydney, NSW, Australiaezymart.com.au

Farmers

Farmers (Farmers Trading Company Ltd) is a New Zealand mid‑market department store chain selling family fashion, beauty products, homewares, furniture, appliances and related goods through physical stores and online.

Flat Bush, Auckland, New Zealandfarmers.co.nz

Fast Times Skateboarding

Fast Times Skateboarding is an Australian skate shop chain and online retailer selling skateboards, apparel, footwear, and accessories, with stores across major shopping centres nationwide.

Melbourne, Victoria, Australiafasttimes.com.au

Fig & Bloom

Fig & Bloom is an Australian florist and online flower delivery company specializing in contemporary floral arrangements, indoor plants, and curated gifts delivered across major cities and regional areas.

Fairfield, Victoria, Australiafigandbloom.com

Florage

Florage is an eco‑friendly florist and hamper business offering design-led, sustainable floral arrangements and curated gift hampers, with stores in Launceston and Hobart, Tasmania.

Launceston, Tasmania, Australiaflorage.com.au

Flowers A Bunch

Flowers A Bunch is a local florist in Campbelltown, New South Wales, offering fresh flower arrangements and same‑day delivery for occasions such as birthdays, funerals, and other events across Campbelltown and surrounding suburbs.

Campbelltown, New South Wales, Australiaflowersabunch.com.au

Fully Charged

Australian retailer specializing in electric personal mobility devices such as e-bikes and other performance electric machines, along with related parts and servicing.

Brisbane, Queensland, Australiafullycharged.biz

Giant Lygon St

Independent bicycle shop in Brunswick East, Victoria, operating as an official Giant bicycle dealer and offering bike sales, accessories, and servicing. The store has served the local cycling community since 1991 and was formerly known as Lygon Cycles.

Brunswick East, Victoria, Australiagiantlygonst.com.au

Godfreys

Godfreys is an Australian retail chain specializing in vacuum cleaners, floor care appliances, and cleaning products for home and commercial use.

Braybrook, Victoria, Australiagodfreys.com.au

Gormans Florist

Gormans Florist is a local florist in Canberra that sells fresh and artificial flowers, plants and gift items, and offers floral arrangement and delivery services for occasions such as weddings, birthdays and funerals.

Belconnen, Australian Capital Territory, Australiagormansbelconnenflorist.com.au

Green Dolphin

Green Dolphin is an Australian-owned manufacturer and wholesaler/retailer of cleaning chemicals, paper consumables, bin liners and related cleaning products serving hospitality and commercial customers, primarily in Melbourne.

Keysborough, Victoria, Australiagreendolphin.com.au

Green Pack

Australian-based importer, wholesaler, and online retailer of eco-friendly, compostable and biodegradable food service packaging and tableware, supplying businesses, events, and individuals nationwide.

Billinudgel, New South Wales, Australiagreenpack.com.au

HALO Branded Solutions

HALO Branded Solutions is a promotional marketing company that designs and supplies branded merchandise, corporate apparel, and recognition products for businesses and organizations.

Sterling, ILhalo.com

HART Sport

HART Sport is an Australian retailer and manufacturer of sporting goods and fitness equipment, supplying schools, clubs, and individuals with gear for a wide range of sports and activities.

Brisbane, Queensland, Australiahartsport.com.au

Hamilton Island Chandlery

Hamilton Island Chandlery is the marine chandlery and provisioning store within Hamilton Island Marina, supplying boating equipment, gas refills, charts and general marine supplies for visiting vessels in the Whitsundays.

Hamilton Island, Queensland, Australiahamiltonisland.com.au

Harper & Lulu

Harper & Lulu is a Newcastle-based small business specializing in beautifully curated gift hampers featuring locally sourced gourmet products, homewares, and candles.

Newcastle, New South Wales, Australiaharperandlulu.com

Harris Scarfe

Harris Scarfe is an Australian department store chain selling homewares, manchester, kitchenware, and apparel. It operates mid-market stores across Australia, often in shopping centres and CBD locations.

Adelaide, South Australia, Australiaharrisscarfe.com.au

Harvey Norman

Harvey Norman is an Australian multinational retail chain selling furniture, bedding, computers, consumer electronics, and home appliances, primarily through large-format stores and franchises.

Homebush West, Sydney, Australiaharveynorman.com.au

Henry's Beer Wine & Spirits

Henry's Beer Wine & Spirits is a New Zealand liquor retail chain offering a wide range of beer, wine, spirits, and RTDs for off-premise consumption.

Christchurch, New Zealandhenrys.co.nz

House of Snog Pty Ltd

House of Snog Pty Ltd is a small Australian proprietary company based in New South Wales, likely operating a local retail or services business (possibly in the costume, fashion, or party-goods space) in the Surry Hills/Sydney area.

Sydney, New South Wales, Australia

Howards Storage World

Howards Storage World is an Australian specialty retail chain focused on home organisation and storage products for kitchen, wardrobe, bathroom, laundry, and garage.

Frenchs Forest, New South Wales, Australiahsw.com.au

IWC Schaffhausen

IWC Schaffhausen, legally IWC International Watch Co. AG, is a Swiss luxury watch manufacturer known for high-end mechanical timepieces and iconic collections such as the Portugieser and Pilot’s Watches.

Schaffhausen, Switzerlandiwc.com

JasonL

JasonL is an Australian retailer specializing in office furniture and workplace fit-outs, selling desks, chairs, storage, and related office furnishings primarily online and via commercial sales.

Sydney, New South Wales, Australiajasonl.com.au

JustBoards

JustBoards is an Australian-owned retailer and supplier of whiteboards, glassboards, pinboards, notice boards, and related display products for schools, offices, and other organisations.

Brisbane, Queensland, Australiajustboards.com.au

Juvitha Pty Ltd

Australian proprietary company that trades under brands including Juergens & Co., producing custom handcrafted presentation boxes, portfolios, folders, books and related packaging products, primarily for business and premium presentation uses.

Ultimo, New South Wales, Australiajuergens.com.au

Kaisercraft

Kaisercraft is an Australian arts, crafts, and stationery retailer and wholesaler, offering scrapbooking supplies, paper craft products, and home dĂŠcor items.

Gepps Cross, South Australia, Australiakaisercraft.com.au

Kami Paper

Kami Paper is a Melbourne-based specialty paper and stationery retailer offering artisan, decorative, and handmade papers, journals, albums, cards, and related stationery products sourced from around the world.

Fitzroy, Victoria, Australiakamipaper.com.au

KeepCup

KeepCup is an Australian company that designs and sells reusable coffee cups and drinkware aimed at reducing single-use waste, supplying both consumers and cafĂŠs worldwide.

Melbourne, Australiakeepcup.com

KegLand

KegLand is an Australian retailer and manufacturer specializing in homebrewing, kegging, and draft beer equipment and supplies.

Springvale, Victoria, Australiakegland.com.au

Kikarse Workwear

Kikarse Workwear is an Australian retailer and distributor of industrial workwear, uniforms, safety footwear, personal protective equipment, and related safety products for trades and workplaces.

Waterloo, New South Wales, Australiakikarse.com

Kinokuniya

Kinokuniya is an international bookstore chain originating from Japan, offering a wide selection of English, Japanese, and other language books, magazines, manga, and related merchandise. The Sydney charge refers to its large flagship store in Sydney, Australia.

Tokyo, Japankinokuniya.com

Kitchen Warehouse

Kitchen Warehouse is an Australian retailer and online store specializing in kitchenware, cookware, tableware, and home entertaining products.

Perth, Western Australia, Australiakitchenwarehouse.com.au

Kmart

Kmart is a discount department store chain in Australia and New Zealand offering low-priced apparel, homewares, toys, electronics accessories, and everyday household goods.

Mulgrave, Melbourne, Victoria, Australiakmart.com.au

Kmart Photos

Kmart Photos is Kmart Australia’s photo printing service, offering online and in-store printing of photos, photo books, canvases, and personalized photo gifts for pickup at Kmart stores or home delivery.

Mulgrave, Victoria, Australiakmartphotos.com.au

Koko Black

Koko Black is an Australian premium chocolatier operating boutique chocolate shops and salons offering handcrafted chocolates, gifts, and drinks.

Melbourne, Victoria, Australiakokoblack.com

Konnect Fastening Systems

Konnect Fastening Systems is an industrial supplier specializing in fasteners, tools, and related hardware for construction, mining, manufacturing, and other industrial sectors across Australia and New Zealand.

Thomastown, Victoria, Australiakonnectfasteningsystems.com.au

Koorong

Koorong is an Australian Christian bookstore chain and online retailer specializing in Christian books, Bibles, music, DVDs, gifts, and church resources.

West Ryde, New South Wales, Australiakoorong.com

L&R Great Value

L&R Great Value is an independent discount and variety store in Wollongong, Australia, selling low-cost homewares, gifts, craft supplies, stationery, costumes, toys, and other general merchandise.

Wollongong, New South Wales, Australia

LEGO Certified Store

Licensed LEGO Certified Stores are branded retail shops selling official LEGO sets, accessories, and related merchandise, operated by third-party partners under license from the LEGO Group.

Billund, Denmarklego.com

Labelcity

Labelcity is an Australian supplier of Dymo, Brother, Seiko and compatible labels and label printers, providing labeling products and accessories to businesses across Australia via online and phone orders.

Vineyard, New South Wales, Australialabelcity.com.au

Lincraft

Lincraft is an Australian retail chain specializing in fabrics, craft supplies, haberdashery, and related home sewing and DIY materials.

Sydney, NSW, Australialincraft.com.au

Liquorland

Liquorland is an Australian retail chain of liquor stores selling beer, wine, spirits and other alcoholic beverages through a nationwide network of bottle shops and online ordering.

Hawthorn East, Victoria, Australialiquorland.com.au

Lonsdale Store Pty Ltd

Likely a small independently owned convenience or general retail store trading on Lonsdale Street in Melbourne, operated under the company name Lonsdale Store Pty Ltd.

Melbourne, Victoria, Australia

Love Tea

Love Tea is an Australian company that blends and sells organic, fairly traded specialty teas and herbal infusions through online retail and wholesale channels.

Geelong, Victoria, Australialovetea.com.au

MINISO

MINISO is a global Chinese lifestyle and variety retail brand selling affordable household goods, toys, beauty products, stationery, and other everyday consumer items, often featuring licensed and in-house character IP designs.

Guangzhou, Chinaminiso.com

Macy's

Macy's is a national department store chain offering clothing, accessories, beauty products, home goods, and other general merchandise.

New York, NYmacys.com

Made Retail Systems

Made Retail Systems is an Australian-owned manufacturer and distributor of retail fixtures, mannequins, and visual merchandising accessories, providing custom metal fabrication and shopfitting solutions for retail and commercial environments.

Lynbrook, Victoria, Australiamaderetail.com.au

Market Place Newsagency

Independent newsagency and lottery outlet offering newspapers, magazines, cards, stationery, transport tickets, postage items, lottery products and small gifts, located within Pennant Hills Market Place shopping centre.

Pennant Hills, New South Wales, Australia

Marrickville Metro Newsagency

Marrickville Metro Newsagency is a local newsagent and gift shop in the Marrickville Metro shopping centre, selling newspapers, magazines, lottery products, stationery, greeting cards, gifts and related items.

Marrickville, New South Wales, Australia

Marshalls

Marshalls is an off-price department store chain offering discounted brand-name and designer clothing, footwear, home goods, and accessories.

Framingham, MAmarshalls.com

Master 7 Days Pty Ltd

Master 7 Days Pty Ltd is a Queensland-based Australian private company that appears to operate a small local retail or convenience-type business trading under the "Master 7 Days" name in the Gold Coast area.

Queensland, Australia

Matilda Bookshop

Matilda Bookshop is an independent bookstore in the Adelaide Hills specializing in new-release fiction, gardening, cooking, art and design, current affairs, biography, history, and children’s books, along with selected stationery and gifts.

Stirling, South Australia, Australiamatildabookshop.com.au

Max Displays

Max Displays is an Australian company that designs, manufactures, and sells retail branding materials, exhibition displays, banners, acrylic plinths, and other point-of-sale and trade show display products.

Glendenning, New South Wales, Australiamaxdisplays.com.au

McCauley's Bottleshop

McCauley's Bottleshop is an independent liquor retailer in Port Stephens, offering a wide range of beer, wine, spirits and related products, with drive-through, click-and-collect, and local delivery services.

Salamander Bay, New South Wales, Australiamccauley.net.au

Moonee Ponds Keys Plus

Moonee Ponds Keys Plus is a local key duplication and locksmith shop in Moonee Ponds offering key cutting, car key services, lock repairs, and related security products.

Moonee Ponds, Victoria, Australiayes-we-do-repair-keys.business.site

My Choice

Local retail shop trading under the name "My Choice" at 92 Parramatta Road in Lidcombe, New South Wales, offering general shop/variety retail goods.

Lidcombe, NSW, Australia

My Family Planner

My Family Planner is an Australian, family-owned online store that sells magnetic planners, calendars, and organisational tools designed to help families manage weekly, monthly, and meal planning at home.

Australiamyfamilyweeklyplanner.com.au

Myer

Myer is a major Australian department store chain offering fashion, beauty, homewares, electrical goods, toys, and general merchandise both in-store and online.

Docklands, Victoria, Australiamyer.com.au

Myer Centre Adelaide

Myer Centre Adelaide is a multi-level shopping centre in Adelaide’s Rundle Mall, featuring South Australia’s largest Myer department store along with dozens of specialty retailers, services, and a large food court.

Adelaide, South Australia, Australiamyercentreadelaide.com.au

MĂźller

MĂźller is a large European retail and drugstore chain offering a wide assortment of health and beauty products, household goods, toys, stationery, multimedia, and more.

Ulm, Germanymueller.de

NGV Design Store

NGV Design Store (often referred to as the NGV Bookshop) is the official retail store of the National Gallery of Victoria, selling art books, exhibition catalogues, design objects, and related gifts.

Melbourne, Victoria, Australiangv.vic.gov.au

Nappy Land

Nappy Land is an Australian retail and wholesale brand that sells baby nappies, adult continence products, wet wipes and related household and care supplies, operating warehouses and outlets in multiple suburbs including Noble Park North in Victoria.

Noble Park North, Victoria, Australianansupplies.com.au

National Storage

National Storage is an Australian self-storage provider offering storage units, vehicle storage, and related services for personal and business customers across a network of facilities.

Brisbane, Queensland, Australianationalstorage.com.au

Nationals Convenience Stores

Nationals Convenience Stores is a local convenience shop in Brisbane’s CBD offering snacks, drinks, and everyday grocery and convenience items to nearby workers, residents, and visitors.

Brisbane City, Queensland, Australia

Ned's

Ned's is a South Australian variety retail chain focused on gifts, homewares, decorator items and other discount variety merchandise.

Lonsdale, South Australia, Australianeds.net.au

Nettwork Trading Pty Ltd

Nettwork Trading Pty Ltd is an Australian proprietary company that has operated various small businesses, including an Asian supermarket, a café, and a family daycare service. Card descriptors referencing “Milton AUS” likely relate to one of its former Queensland retail or hospitality locations.

Queensland 4172, Australia

News Travels

News Travels is an airport newsagency and travel essentials retail brand offering books, magazines, convenience items and travel accessories at Brisbane Airport and other Australian airport terminals, operated by travel retailer Lagardère AWPL.

Sydney, Australiaawpl.com.au

News@BNE

News@BNE is a travel retail news, books, convenience and travel‑essentials store concept located inside Brisbane Airport, operated as part of the airport’s retail offering by specialist travel retailer Lagardère AWPL.

Sydney, New South Wales, Australiabne.com.au

News@Terrigal

News@Terrigal is a local newsagency and gift shop offering newspapers, magazines, stationery, greeting cards, gifts and souvenirs in Terrigal, New South Wales.

Terrigal, New South Wales, Australianewspower.com.au

NewsLink

NewsLink is a chain of news, books, and convenience retail stores primarily located in airports and transport hubs across Australia.

Sydney, Australianewslink.com.au

Nextra

Nextra is an Australian newsagency franchise group whose member stores sell newspapers, magazines, greeting cards, gifts, stationery, lottery products and related retail items. The Chermside locations trade as Nextra or Nextra Express within Westfield Chermside, serving local customers’ news and gift needs.

Newstead, Queensland, Australianextra.com.au

Nick's Wine Merchants

Nick's Wine Merchants is an Australian independent wine and spirits retailer offering a wide selection of wines, whiskies, and other alcoholic beverages both in-store and online.

Doncaster East, Victoria, Australianicks.com.au

Nisbets

Nisbets is a commercial catering and hospitality equipment supplier, selling kitchen appliances, utensils, furniture, and related supplies to restaurants, cafes, hotels, and other foodservice businesses through online, catalog, and retail channels.

Bristol, United Kingdomnisbets.com

Officeworks

Officeworks is an Australian chain of office supplies, technology, furniture, and stationery stores serving consumers, students, and businesses.

Melbourne, Victoria, Australiaofficeworks.com.au

Olympic Park Convenience Store

Independent convenience store offering snacks, drinks, basic groceries, and everyday essentials, located in the Sydney Olympic Park precinct.

Sydney Olympic Park, New South Wales, Australiacityconveniencestore.com

One Star Variety Shop

One Star Variety Shop is a local discount and variety store located in Manor Lakes Central Shopping Centre in Wyndham Vale, Victoria, selling low-cost household items, gifts, and general merchandise.

Wyndham Vale, VIC, Australia

Outdoors Warehouse

Outdoors Warehouse is an Australian online retailer specializing in camping, hunting, fishing and general outdoor gear and accessories.

Carrara, Queensland, Australiaoutdoorswarehouse.com.au

Oxford Street Newsagency

Independent newsagency and convenience retailer selling newspapers, magazines, lottery tickets, greeting cards and related everyday items in Bulimba, Queensland.

Bulimba, Queensland, Australia

Panache Flowers

Panache Flowers is a long-established Melbourne florist offering fresh floral arrangements, bouquets, plants, and gifts with same-day delivery across Hawthorn and wider Melbourne.

Hawthorn, Victoria, Australiapanacheflowers.com.au

Paper Plus

Paper Plus is a New Zealand retail chain selling books, stationery, gifts, cards, and related office and school supplies.

Auckland, New Zealandpaperplus.co.nz

Paramount Liquor

Paramount Liquor is a family-owned Australian liquor wholesaler that supplies a wide range of beer, wine, spirits and non-alcoholic beverages to hospitality venues and retail customers across Australia.

Derrimut, Victoria, Australiaparamountliquor.com.au

Paraphernalia

Paraphernalia is an independent gift and homewares shop offering a wide range of gifts, home goods, jewellery, children’s items, candles, and accessories from local and trusted brands.

Parap, Darwin, Northern Territory, Australia

Pearsons Florist

Pearsons Florist is a third-generation, family-owned Australian florist offering luxury flower arrangements, indoor plants, and gift hampers with same-day delivery across Sydney and Melbourne, plus online ordering nationwide.

Sydney, New South Wales, Australiapearsonsflorist.com.au

Performance Sports Nutrition

Performance Sports Nutrition is an independent supplement and health food retailer in North Sydney offering sports nutrition products, vitamins, minerals and made-to-order protein shakes, along with training and diet advice.

North Sydney, New South Wales, Australiapsnutrition.com.au

Petals and Leaves

Petals and Leaves is a family-run florist in north-west and western Sydney offering fresh flowers, plants, gift hampers and floral design services for occasions, weddings and everyday gifting.

Baulkham Hills, NSW, Australiapetalsandleaves.com.au

Phillip & Lea

Phillip & Lea is an Australian retailer and online store specializing in high-quality, durable tools and wares for cooking, gardening, baking, preserving and related home crafts, curated for long-term use.

Fitzroy, Victoria, Australiaphillipandlea.com.au

Promotions Warehouse

Promotions Warehouse is an Australian promotional products supplier offering branded merchandise such as apparel, drinkware, bags, stationery, and corporate gifts to businesses nationwide.

Melbourne, Victoria, Australiapromotionswarehouse.com.au

Provender

Provender is an Australia-wide vending and unattended retail company that provides and services snack, drink, fresh food, coffee and micro-market vending solutions for workplaces, gyms, schools, hospitals and other sites.

Silverwater, New South Wales, Australiaprovender.au

QCC Hospitality Supplies

QCC Hospitality Supplies is an Australian-owned wholesale distributor and retailer of non‑food hospitality supplies, providing equipment, tableware, disposables, janitorial and related products to cafés, restaurants, hotels, aged care facilities and other venues nationwide.

Sydney, NSW, Australiaqcc.com.au

RENTaCAM Sydney

RENTaCAM Sydney is a camera and video equipment rental business offering cameras, lenses, lighting and related accessories for hire to photographers and videographers in the Sydney area.

St Peters, New South Wales, Australiarentacam.sydney

RSEA Safety

RSEA Safety is a leading independent retailer and B2B provider of workwear, personal protective equipment (PPE), and safety solutions, including road and workplace safety equipment, across Australia and New Zealand.

Glen Iris, Victoria, Australiarsea.com.au

Raine Square

Raine Square is a mixed-use shopping, dining, and entertainment precinct in the Perth CBD, featuring retail stores, restaurants, cafes, a cinema and office space.

Perth, Western Australia, Australiarainesquare.com.au

Rebel

Rebel is an Australian sporting goods and activewear retailer selling sports equipment, apparel, and footwear through a nationwide chain of stores and online.

Rhodes, New South Wales, Australiarebelsport.com.au

Red Bottle

Red Bottle is a group of family-owned, independent liquor stores in Sydney offering a curated range of wine, beer, spirits, and specialty Asian liquors, with both in-store sales and online ordering.

Sydney, New South Wales, Australiaredbottle.com.au

Relay

Relay is an international travel retail chain of convenience, news, and book stores commonly located in airports, train stations, and other transit hubs.

Paris, Francerelay.com

Revaeb Pty Ltd

Revaeb Pty Ltd is an Australian proprietary company based in Port Melbourne (postcode 3207), likely operating a local liquor/bottle shop at 411 Graham Street that trades under a banner such as Cellarbrations or Liquor Stax.

Port Melbourne, Victoria, Australia

Rexel

Rexel is a global distributor of electrical supplies, automation products, and energy management solutions serving electricians, contractors, and industrial customers. The descriptor refers to a Rexel electrical supplies branch in Nambour, Australia.

Paris, Francerexel.com

Ron Leigh's Music Factory

Independent music store and school offering a wide range of musical instruments, accessories, repairs, and in‑store music lessons, serving the Bayside community in Melbourne for over 50 years.

Brighton, Victoria, Australiaronleighsmusicfactory.com.au

Roni's Variety Discounts

Roni's Variety Discounts is an Australian family‑operated discount variety retail chain offering homewares, giftware, party supplies and general merchandise through multiple stores in New South Wales shopping centres.

Sydney, NSW, Australia

SHJ Retail Pty Ltd

Likely a small local retail business operating under the corporate entity SHJ Retail Pty Ltd in Broadbeach, Australia. Public information about this company and its specific retail segment is not readily available.

Broadbeach, Queensland, Australia

Safety Xpress

Safety Xpress is an Australian supplier of workplace and pedestrian safety products, including speed humps, bollards, wheel stops, tactile indicators, and other site safety equipment for commercial, industrial, and public environments.

Scoresby, Victoria, Australiasafetyxpress.com.au

Sarah's Flowers

Sarah's Flowers is an Australian online florist and gift delivery service offering flower arrangements and hampers for occasions such as birthdays, anniversaries, and sympathy.

Brisbane, QLD, Australiasarahsflowers.com.au

Science Equip

Science Equip (Science Equip Pty Ltd) is an Australian laboratory equipment and consumables supplier offering glassware, plasticware, silicaware, instruments and other scientific supplies to education, research, medical and industrial customers.

Hoppers Crossing, Victoria, Australiascienceequip.com.au

Shiploads

Shiploads is an Australian discount variety retailer offering low-priced homewares, cleaning products, garden supplies, toys, confectionery, seasonal items and other general merchandise.

Hobart, Tasmania, Australiashiploads.com.au

Shirdi Sai Baba Store

Small local retail shop likely selling Indian devotional items, religious statues, photos, and related goods associated with Shirdi Sai Baba, serving the Southport community in Queensland, Australia.

Southport, Queensland, Australia

Shire Sweets and Gifts

Shire Sweets and Gifts is an independent candy and chocolate shop in Engadine, New South Wales, offering a wide range of confectionery, gift hampers, and party sweets including Australian and imported lollies and chocolates.

Engadine, New South Wales, Australiashiresweets.com.au

Shisha Lobby

Shisha Lobby is a small local retail shop in Smithfield, New South Wales, offering shisha-related products and gifts.

Smithfield, New South Wales, Australia

Shivay Brothers Pty Ltd

Shivay Brothers Pty Ltd is a small Australian private company based in Western Australia, likely operating a local retail outlet such as a convenience or general goods store in the Midvale area.

Balcatta, Western Australia, Australia

Shoalhaven Uniforms

Shoalhaven Uniforms is an Australian-owned, family-run business that supplies custom uniforms, workwear, PPE, and promotional merchandise, along with in‑house embroidery and printing services.

Huskisson, New South Wales, Australiashoalhavenuniforms.com.au

Shoalwater News and Lotteries

Shoalwater News and Lotteries is a local newsagency and lottery outlet located in the Shoalwater Shopping Centre, selling newspapers, magazines, stationery and Lotterywest tickets.

Shoalwater, Western Australia, Australia

Shoe Express

Shoe Express is an Australian retail and service chain offering shoe and bag repairs, key cutting, engraving, watch repairs, batteries and related services, with kiosks in multiple Victorian shopping centres including Craigieburn.

Melbourne, Victoria, Australiashoeexpress.net.au

Shoe Hospital

Local shoe repair and footwear service shop in Wynnum, Queensland, offering shoe repairs, footwear maintenance, and related services such as engraving.

Wynnum, Queensland, Australia

Shoe Repairs Plus

Shoe Repairs Plus is a local shoe repair shop in Eltham, Victoria offering shoe and leather repairs, key cutting, watch and jewellery repairs, engraving, and related services.

Eltham, Victoria, Australiashoerepairsplus.websyte.com.au

Shoe Talk

Shoe Talk is an Australian independent footwear retailer offering a wide range of men’s, women’s and children’s shoes, including comfort, sports and school footwear from major brands. The company operates multiple stores in the Macarthur and Wollondilly regions, including Narellan, Camden and Tahmoor.

Camden, New South Wales, Australiashoetalk.com.au

Shoe Warehouse

Shoe Warehouse is an Australian footwear retailer and online store offering discounted men’s, women’s and children’s shoes from major comfort and athletic brands such as Clarks, Hush Puppies, Skechers and Adidas.

Port Melbourne, Victoria, Australiashoewarehouse.com.au

Shoeteria

Shoeteria is a Southern California-based retail chain and e-commerce store specializing in work footwear, safety shoes, and workwear apparel for men and women.

Commerce, CAshoeteria.com

Shoeworld Boutique

Shoeworld Boutique is an independent footwear and accessories retailer located in Inala Plaza, offering a range of shoes and related items often catering to dress and occasion wear.

Inala, Queensland, Australiafacebook.com/shoeworldboutique

Shogun Martial Arts & Boxing Supplies

Shogun Martial Arts & Boxing Supplies is an Australian retailer and online store specializing in martial arts and boxing equipment, uniforms, protective gear, and training accessories, shipping products Australia-wide from its Sydney-area base.

Jamisontown, New South Wales, Australiashogunmartialarts.com.au

Shoo Zone

Shoo Zone is an independent shoe retailer in Warragul, Victoria, offering a range of fashionable footwear and accessories for women, men, and children.

Warragul, Victoria, Australiashoozone.com.au

Shooters Wholesale Warehouse

Shooters Wholesale Warehouse is a firearms and sporting goods retailer in Canberra, selling guns, ammunition, hunting gear and related accessories to licensed shooters and hunters.

Mitchell, Australian Capital Territory, Australiashooters.com.au

Shop $mart

Shop $mart is a local discount and variety store offering a wide range of household items and general merchandise at low prices, using the slogan "Good Stuff Cheap."

Rockhampton City, Queensland, Australiashopsmart0.wixsite.com/shopsmart

Shop for Shops

Shop for Shops is an Australian supplier of retail shopfittings, displays, shelving, and storage solutions for stores and commercial spaces.

Collingwood, Victoria, Australiashopforshops.com

Shopfittings Direct Pty Ltd

Shopfittings Direct Pty Ltd is an Australian supplier of retail shopfitting equipment, providing shelving systems, slatwall panels, glass display cabinets, counters, mannequins and other store fixtures to retailers nationwide.

Gregory Hills, New South Wales, Australiashopfittingsdirect.com.au

Shopfittings Store

Shopfittings Store is an Australian, family-owned retailer and wholesaler of shopfitting equipment, providing shelving, gondolas, slatwall panels, garment racks, mannequins, display systems and other retail fixtures with Australia-wide delivery.

Molendinar, Queensland, Australiashopfittingsstore.com.au

Shopgrab Pty Ltd

Shopgrab Pty Ltd appears to be a small Australian proprietary company trading under the name "Shopgrab", likely operating a local retail outlet rather than a widely known national brand. Public business registers list the company but do not provide detail on its specific line of trade.

Five Dock, New South Wales, Australia

Signet

Signet is an Australian company that manufactures and distributes industrial consumables, including packaging, safety, cleaning and warehouse supplies, serving businesses nationwide through multiple distribution centres and online ordering.

Wakerley, Queensland, Australiasignet.net.au

Spirits On Jasper

Spirits On Jasper is a liquor store and bottle shop on Jasper Avenue in Edmonton, Alberta, offering a wide selection of spirits, wine, beer, and related products.

Edmonton, Alberta, Canada

Spotlight

Spotlight is an Australian family-owned retail chain of large-format stores specializing in fabrics, sewing and craft supplies, home dĂŠcor, manchester, window furnishings, and party goods, with locations across Australia, New Zealand, and parts of Asia.

South Melbourne, Victoria, Australiaspotlightstores.com

Staples

Staples is a retail company specializing in office supplies, technology products, furniture, and business services for consumers and businesses.

Framingham, MAstaples.com

Stareast International

Stareast International is an Australian-owned distributor and retailer of appliance spare parts and HVAC/R equipment, supplying commercial and domestic refrigeration, air conditioning and household appliance parts across Australia and New Zealand.

Padstow, New South Wales, Australiastareast.com.au

Stockroom

Stockroom is a contemporary art gallery and retail space featuring exhibitions alongside a store selling jewellery, ceramics, homewares, furniture, fashion and other design objects.

Kyneton, Victoria, Australiastockroomspace.com

Sunrise Cellars

Sunrise Cellars is an independent, family-owned bottle shop in Byron Bay offering a wide range of Australian and imported wines, beers, spirits, and ciders, along with regular in‑store specials.

Byron Bay, NSW, Australiasunrise-cellars.shop.supercellars.com.au

Supa Bargains

Supa Bargains is an Australian discount and variety store offering a wide range of low‑priced household goods, party supplies, stationery, toys, gifts, and general merchandise.

Melbourne, Victoria, Australiam.facebook.com/supabargains

Super Retail Group

Super Retail Group is an Australian retail company that owns and operates chains such as Supercheap Auto, Rebel, BCF (Boating, Camping, Fishing) and Macpac, focusing on automotive, sporting goods, and outdoor leisure products.

Brisbane, Queensland, Australiasuperretailgroup.com.au

Surf Liquor and Wine

Surf Liquor and Wine is an independent neighborhood liquor and convenience store offering a wide selection of wines, spirits, beer, and snacks in Santa Monica, California.

Santa Monica, CAsurfliquors.com

Sydney Markets Plaza

Sydney Markets Plaza is a business and shopping centre within the Sydney Markets precinct at Flemington/Homebush West, housing a supermarket, hotel, post office and multiple specialty retailers and services.

Homebush West (Sydney Markets), New South Wales, Australiasydneymarkets.com.au

Sydney Party Decorations

Sydney Party Decorations is an Australian party-supplies retail chain offering decorations, balloons, costumes, accessories and themed party goods through multiple mega warehouse and CBD stores around Sydney.

Sydney, NSW, Australiasydneypartydecorations.com.au

Sydney Rope Supplies

Sydney Rope Supplies is a family-owned Australian business that sells a wide range of rope and cordage products for marine, industrial, agricultural, mining, and general-purpose use, primarily through its online store and warehouse in New South Wales.

Kurnell, New South Wales, Australiasydneyropesupplies.com.au

Sydney Tools

Sydney Tools is an Australian retailer specializing in power tools, hand tools, construction equipment, and related trade and industrial supplies for professionals and DIY customers.

Sydney, New South Wales, Australiasydneytools.com.au

T2 Tea

T2 Tea is an Australian specialty tea retailer that sells loose-leaf teas, teabags, and teaware through branded stores and online channels.

Collingwood, Victoria, Australiat2tea.com

Taren Cleaning Supplies

Taren Cleaning Supplies is an Australian-owned company that supplies cleaning chemicals, accessories, and related products, with a focus on childcare, aged care, hospitality, and educational institutions.

Kurnell, New South Wales, Australiataren.com.au

Target

Target is an Australian discount department store chain offering affordable clothing, homewares, electronics, toys, and other general merchandise both in-store and online.

Williams Landing, Victoria, Australiatarget.com.au

Technique Tools

Technique Tools is an Australian retailer specializing in bricklaying and masonry tools, equipment, and accessories for construction professionals and tradespeople.

Melbourne, Victoria, Australiatechniquetools.com.au

Tentworld

Tentworld is an Australian outdoor and camping retailer selling tents, camping gear, hiking equipment, and related accessories through physical stores and an online shop.

Toowoomba, Queensland, Australiatentworld.com.au

The Art & Craft Company

The Art & Craft Company is an Irish art supply retailer and online store selling fine art materials, craft supplies, hobby products, and educational resources to schools, artists, and crafters.

Ennis, County Clare, Irelandartandcraft.ie

The Base Warehouse

The Base Warehouse is an Australian discount variety, party supplies, and homewares retailer offering costumes, balloons, decorations, everyday essentials, and home decor through multiple New South Wales stores and an online shop.

Gregory Hills, New South Wales, Australiathebasewarehouse.com.au

The Book Room Collective

The Book Room Collective is an independent, locally owned group of bookstores in Australia’s Northern Rivers region, with shops in Byron Bay and Lennox Head offering a curated selection of books and related gifts.

Byron Bay, New South Wales, Australiathebookroomcollective.com

The Bottle Shop

The Bottle Shop is a boutique liquor store within Sydney’s Ivy precinct, offering a curated selection of wine, beer and spirits chosen by Merivale’s sommeliers and also serving as the retail arm of Merivale’s broader beverage program.

Sydney, New South Wales, Australiamerivale.com

The Cellar

The Cellar is an independent liquor retail group operating bottle shops in Byron Bay, Bangalow, Ballina, Alstonville and surrounding areas, offering a wide range of beer, wine and spirits and event supply services.

Byron Bay, New South Wales, Australiathecellar.com.au

The Cheesecake Shop

The Cheesecake Shop is a franchised bakery chain specializing in freshly baked cheesecakes, mudcakes, tortes and custom celebration cakes, with more than 250 stores across Australia and New Zealand.

Villawood, New South Wales, Australiacheesecake.com.au

The District Docklands

The District Docklands is a large indoor/outdoor shopping, dining, and entertainment precinct featuring retail stores, fresh food outlets, restaurants, cinemas, and attractions in Melbourne’s Docklands area.

Docklands, Victoria, Australiathedistrictdocklands.com.au

The Flower Spot

The Flower Spot is a locally owned florist in Bendigo, Victoria, offering fresh floral arrangements, wedding flowers, hampers and gift items for delivery and in‑store purchase.

Bendigo, Victoria, Australiatheflowerspot.com.au

The Lucky Charm

The Lucky Charm is an Australian newsagency franchise offering stationery, printer consumables, greeting cards, gifts, magazines, lottery products and related retail services through dozens of franchised stores nationwide, including The Lucky Charm Redcliffe in Queensland.

Perth, Western Australia, Australiatheluckycharm.com.au

The Melbourne Food Depot

The Melbourne Food Depot is a specialist supplier of premium food ingredients, additives and related products, selling in small and bulk quantities to food manufacturers, chefs, cosmetic formulators and hobbyists via its online store.

Melbourne, Victoria, Australiamelbournefooddepot.com

The Reject Shop

The Reject Shop is an Australian discount variety store chain offering low-priced everyday consumer goods including groceries, homewares, cleaning products, party supplies, seasonal items, and general merchandise.

Melbourne, Victoria, Australiarejectshop.com.au

The Resource Group Pty Ltd

The Resource Group Pty Ltd is an Australian promotional products and branding supplier based in New South Wales, providing custom merchandise and marketing items to businesses and organizations. It appears to be part of the broader TRG (The Resource Group) network, an investment holding company focused on business process outsourcing and related services.

Rouse Hill, New South Wales, Australiatrgworld.com

The Running Company

The Running Company is an Australian specialty running retailer offering premium running shoes, apparel, and gait-analysis-based fitting services for runners of all abilities, both in-store and online.

Hyde Park, South Australia, Australiatherunningcompany.com.au

The Shoe Kings

The Shoe Kings is an Australian chain of mall kiosks offering shoe repairs, leather refurbishment, key cutting, engraving, and related accessories and giftware services.

Perth, Western Australia, Australiashoekings.com.au

The Therapy Store

The Therapy Store is an Australian educational supply and toy retailer specializing in therapy toys, special-needs resources, and learning materials for children and adults of all abilities.

Brunswick East, Victoria, Australiathetherapystore.com.au

The Warehouse

The Warehouse is a New Zealand discount department store chain selling a wide range of general merchandise including clothing, homewares, electronics, toys, and groceries.

Auckland, New Zealandthewarehouse.co.nz

The Wrapping Paper Company

The Wrapping Paper Company (Wrapco) is an Australian family-owned wholesale designer and manufacturer of environmentally sustainable gift wrapping paper and related gift-wrap accessories for retailers and corporate clients.

Braeside, Victoria, Australiawrapco.com.au

Tobacconist Z.A

Tobacconist Z.A is an independent tobacco shop offering cigarettes, cigars, tobacco products and related accessories to local customers in Campbelltown, New South Wales.

Campbelltown, New South Wales, Australia

Today Duty Free

Today Duty Free is the main duty-free retail concept at Amsterdam Airport Schiphol, offering perfumes, cosmetics, liquor, confectionery and other travel retail products to passengers after security.

Schiphol, Netherlandsschiphol.nl

Total Tools

Total Tools is an Australian retailer specializing in professional-quality tools, equipment, and accessories for tradespeople and serious DIY customers, operating through a network of franchised and company-owned stores.

Melbourne, Victoria, Australiatotaltools.com.au

TradeTools

TradeTools is an Australian retailer specializing in tools, equipment, and accessories for tradespeople and DIY customers, operating multiple stores primarily in Queensland.

Loganholme, Queensland, Australiatradetools.com

Tuğba Kuruyemiş

Tuğba Kuruyemiş is a Turkish retail chain specializing in nuts, dried fruits, sweets, Turkish delight, and related snack products.

AydÄąn, Turkeytugbakuruyemis.com.tr

Typo

Typo is a specialty retail brand selling stationery, gifts, home dĂŠcor, tech accessories, and novelty items, primarily targeting younger consumers.

Geelong, Victoria, Australiatypo.com

Uplifting Solutions

Australian provider of ergonomic and sustainable office furniture solutions, including seating, workstations, tables, storage and workspace fitouts for corporate and government clients.

Smithfield, New South Wales, Australiauplifting.com.au

Urban Attitude

Urban Attitude is a Melbourne-based specialty gift and collectibles retailer known for quirky novelty items, designer toys, books and homewares, with its original and flagship store on Acland Street in St Kilda.

VIC 3204, Australiaurbanattitude.com.au

Vintage Cellars

Vintage Cellars is an Australian retail chain specializing in wine, beer, spirits, and premium liquor products.

Melbourne, Victoria, Australiavintagecellars.com.au

WHSmith

WHSmith is a British travel retailer operating convenience, book and stationery shops in airports, railway stations, hospitals and other travel hubs worldwide, selling books, magazines, snacks, gifts and travel essentials.

London, England, United Kingdomwhsmith.co.uk

WISH Gift Card

WISH Gift Card is a stored-value gift card program operated by Woolworths Group, usable at participating Woolworths Group retail brands across Australia (such as Woolworths supermarkets, Big W, BWS, and others).

Bella Vista, New South Wales, Australiawishgiftcard.com.au

Walmart

Walmart is a large multinational retail chain operating discount department stores, grocery stores, and hypermarkets across the United States and internationally.

Bentonville, ARwalmart.com

Warehouse Stationery

Warehouse Stationery is a New Zealand retail chain selling office supplies, technology products, furniture, art and school supplies, and providing print and copy services both in-store and online.

Auckland, New Zealandwarehousestationery.co.nz

Watermark

Watermark is an airport-based books and news retail concept, often combined with a cafÊ, offering books, magazines, stationery, gifts and light refreshments to travelers. The brand is operated by Lagardère Travel Retail, which runs Watermark outlets in airports including Melbourne Airport (Tullamarine).

Paris, Francelagardere-tr.com

Weekday

Likely a small, local retail business trading under the name "Weekday" that uses Square as its point-of-sale processor in Brisbane, Australia.

Brisbane, Australia

West Coast Fasteners

West Coast Fasteners is a Perth-based industrial supplier specializing in fasteners, construction supplies, tools, safety gear, and related hardware for commercial construction, mining, agricultural, engineering and other industrial customers.

Perth, Western Australia, Australiawestcoastfasteners.com.au

Westfield

Westfield Sydney is a large upmarket shopping centre in Sydney’s central business district, featuring hundreds of retail stores, dining options, and access to the Sydney Tower attraction.

Sydney, New South Wales, Australiawestfield.com.au

Whitcoulls

Whitcoulls is a New Zealand retail chain selling books, stationery, gifts, toys, and related products through stores nationwide and online.

Auckland, New Zealandwhitcoulls.co.nz

Whitworths Marine & Leisure

Whitworths Marine & Leisure is an Australian marine chandlery and retail chain selling boating, sailing, and leisure marine equipment and accessories.

Brookvale, NSW, Australiawhitworths.com.au

Wimmera Bolts & Fasteners

Wimmera Bolts & Fasteners is an independent hardware and industrial supplies retailer specializing in bolts, fasteners, tools, safety gear, and related equipment for trades, agriculture, and industry.

Horsham, Victoria, Australiawimmerabolts.com.au

Wine Republic

Wine Republic is an independent boutique liquor retailer offering a large selection of artisanal wine, craft beer, and specialty spirits through a network of stores in Melbourne, Australia and online.

Melbourne, Victoria, Australiawinerepublic.com.au

Winning Edge Presentations

Australian company specialising in trophies, awards, custom giftware and promotional merchandising for corporate, sporting and public-sector clients.

Richmond, Victoria, Australiawinningedgepresentations.com.au

Wrapt In Flowers

Wrapt In Flowers is an independent florist offering bespoke floral arrangements, wedding and event flowers, workshops, and gift hampers, servicing the Port Stephens region of New South Wales.

Anna Bay, New South Wales, Australiawraptinflowers.com.au

Zokoko

Zokoko is an Australian bean-to-bar chocolate maker that produces premium craft chocolate bars and related confectionery products, operating a factory and retail space in Emu Heights, NSW.

Emu Heights, New South Wales, Australiazokoko.com.au

zoells.de GmbH

zoells.de GmbH is a German vending and snack company that operates snack and beverage machines across Bavaria and also sells vending products and equipment online.

Langenzenn, Germanyzoells.de

Frequently Asked Questions

Why does my retail charge not match the store receipt?

Retail charges may differ due to gift card purchases, returns processed separately, or split transactions for different payment methods.

How do online retail purchases appear?

Online purchases may show the website name, parent company name, or fulfillment center location rather than the specific retailer.

Can't find your charge?

Paste your bank statement codes and we'll identify them for you.

Find out who charged you