M

Merchants starting with "M"

220 merchants found

M.Y. Roasting Cafe

Coffee

M.Y. Roasting Cafe is a local cafe in Yeronga, Brisbane, serving specialty coffee and an all-day breakfast and lunch menu in a family- and dog-friendly setting.

Yeronga, Queensland, Australiamyroastingcafe.com

MACA Cancer 200 Ride for Research

Charity

The MACA Cancer 200 Ride for Research is a 200 km fundraising cycling event in Western Australia that raises money for cancer research conducted by the Harry Perkins Institute of Medical Research.

Nedlands, Western Australia, Australiacancer200.org.au

MACROS

Delivery

MACROS is an Australian ready-made meal delivery service offering chef-prepared, nutritionist-designed meals tailored to various health and fitness goals, delivered fresh (never frozen) to customers’ homes and workplaces across Australia.

Sydney, NSW, Australiamacros.com.au

MCM House

Home & Garden

MCM House is an Australian furniture and homewares retailer specializing in classic contemporary indoor and outdoor furniture, lighting, textiles, rugs and décor that reflect a relaxed Australian lifestyle.

Paddington, New South Wales, Australiamcmhouse.com

MECCA

Personal Care

MECCA is an Australian beauty retailer offering cosmetics, skincare, fragrance, and related beauty products through its MECCA Cosmetica, MECCA Maxima, and MECCA stores and online platform.

Melbourne, Victoria, Australiamecca.com

MFCBill.com

Financial Services

MFCBill.com is a payment processing service that performs secure credit card transaction services and billing support for partner websites, notably including MyFreeCams token purchases.

Valencia, California, United Statesmfcbill.com

MINISO

Retail

MINISO is a global Chinese lifestyle and variety retail brand selling affordable household goods, toys, beauty products, stationery, and other everyday consumer items, often featuring licensed and in-house character IP designs.

Guangzhou, Chinaminiso.com

MJC United Pty Ltd

Other

MJC United Pty Ltd appears to be a small Australian proprietary company based in the Sydney metropolitan area, likely operating as a local trading or holding entity; no clear public information identifies a specific consumer-facing brand or industry focus.

Sydney, NSW 2093, Australia

MMK Walsh Bay Pty Ltd

Grocery

MMK Walsh Bay Pty Ltd is an Australian private company that has traded under the name Walsh Bay Grocery & Fine Food, operating as a local grocery/convenience store and lottery outlet serving the Walsh Bay/Dawes Point area of Sydney.

Sydney, New South Wales, Australia

MOVI Workspace

Home & Garden

MOVI Workspace designs and sells electric, height-adjustable standing desk converters and ergonomic workstation accessories, primarily for home and office use.

Melbourne, Victoria, Australiamoviworkspace.com

MS Plus

Charity

MS Plus (formerly Multiple Sclerosis Limited) is an Australian not‑for‑profit organisation that provides information, support services, and advocacy for people living with multiple sclerosis and other neurological conditions, and raises funds for research and community programs.

Blackburn, Victoria, Australiamsplus.org.au

MSY Technology

Electronics

MSY Technology is an Australian computer and electronics retailer specializing in PC components, peripherals, and related IT hardware and accessories.

Melbourne, Victoria, Australiamsy.com.au

MTC Organic

Grocery

MTC Organic is a small Australian organic food retailer operating under MTC Organic Pty Ltd, offering certified organic and natural grocery products to local customers.

Manly, NSW, Australia

MV Billing

Financial Services

MV Billing is a payment solutions provider that offers secure online billing, subscription management, and customer support services for digital content and other online merchants worldwide.

Offices in the United States and Cyprus (exact headquarters location not clearly specified publicly)mvbilling.com

MYOB

Software

MYOB is an Australian business management and accounting software company providing cloud-based accounting, payroll, tax, and practice management solutions for small to large businesses and accounting firms.

Glen Waverley, Victoria, Australiamyob.com

Maaz Restaurant Pty Ltd

Restaurant

Maaz Restaurant Pty Ltd appears to be a local independent restaurant operating in Auburn, New South Wales, Australia, likely serving casual dine‑in and takeaway meals.

Auburn, New South Wales, Australia

Mac Centre

Electronics

Mac Centre is an Australian IT services and Apple-focused solutions provider that offers Apple device procurement, managed IT services, consulting, and authorised service and support for business and education customers.

Surry Hills, New South Wales, Australiamaccentre.com.au

Mach2

Restaurant

Mach2 is an Italian restaurant and café by the Machiavelli team, offering breakfast, lunch, dinner, and drinks in a 1960s‑style underground dining room in Sydney’s CBD.

Sydney, New South Wales, Australiamachtwo.com.au

Mackay Whitsunday Taxis

Transit

Mackay Whitsunday Taxis is a regional taxi operator providing 24/7 point‑to‑point transport services across the Mackay and Whitsunday areas of Queensland, Australia.

Mackay, Queensland, Australiamackaytaxi.com.au

Macy's

Retail

Macy's is a national department store chain offering clothing, accessories, beauty products, home goods, and other general merchandise.

New York, NYmacys.com

Mad Mex

Fast Food

Mad Mex is an Australian fast-casual restaurant chain serving Mexican-inspired food such as burritos, tacos, and nachos.

Sydney, New South Wales, Australiamadmex.com.au

Mad Mex Fresh Mexican Grill

Fast Food

Mad Mex Fresh Mexican Grill is an Australian fast-food chain serving build-your-own burritos, tacos, nachos and other Mexican-style dishes in a quick-service format.

Sydney, Australiamadmex.com.au

Madame Brussels

Bar

Madame Brussels is a themed rooftop cocktail bar in Melbourne known for its kitschy garden-party decor, AstroTurf floors, and a menu focused on cocktails, punches, and bar snacks.

Melbourne, Victoria, Australiamadamebrussels.com

Made Retail Systems

Retail

Made Retail Systems is an Australian-owned manufacturer and distributor of retail fixtures, mannequins, and visual merchandising accessories, providing custom metal fabrication and shopfitting solutions for retail and commercial environments.

Lynbrook, Victoria, Australiamaderetail.com.au

Made in

Restaurant

Made in Italy is a Sydney-based Italian restaurant group specializing in gourmet pizzas, handmade pastas, and Italian-style catering and delivery, with a flagship location in York Lane in the Sydney CBD.

Sydney, New South Wales, Australiamadeinitaly.com.au

Madlilys Cafe

Coffee

Madlilys Cafe is a small independent coffee shop/café located in London Court in the Perth CBD, serving espresso coffee, light food and baked goods in a cosy, laneway-style setting.

Western Australia, Australia

Mageton Investment Pty Ltd

Financial Services

Mageton Investment Pty Ltd is an Australian proprietary limited company classified in holding and other investment activities, likely operating as a small private investment or holding vehicle rather than a consumer‑facing brand.

North Ryde, New South Wales, Australia (inferred from transaction descriptor; ASIC-style listings only specify Australia generally)

Maggie Beer Products

Grocery

Maggie Beer Products is an Australian food company known for premium gourmet products such as pâtés, fruit pastes, ice creams, stocks, and other specialty pantry items, inspired by chef and food personality Maggie Beer.

Tanunda, South Australia, Australiamaggiebeer.com.au

Magill Estate Kitchen

Restaurant

Magill Estate Kitchen is a casual, winery-based restaurant and deli at Penfolds’ historic Magill Estate, offering relaxed dining, wine pairings, and grab-and-go options overlooking the Penfolds vineyard near Adelaide, South Australia.

Magill, South Australia, Australiamagillestatekitchen.com.au

Maha Restaurant

Restaurant

Maha Restaurant is a modern Middle Eastern fine dining restaurant in Melbourne offering multi-course, sensory-focused menus led by chef Shane Delia.

Melbourne, Victoria, Australiamaharestaurant.com.au

Mail Boxes Etc.

Delivery

Mail Boxes Etc. (MBE) is a global network of franchised business service centres providing shipping, logistics, packing, printing, and marketing solutions for consumers and small and medium-sized businesses.

Milan, Italymbeglobal.com

Mailchimp

Software

Mailchimp is a marketing automation and email marketing platform that helps businesses manage mailing lists, design campaigns, and analyze marketing performance.

Atlanta, GAmailchimp.com

Mailgun

Software

Mailgun is a cloud-based email delivery and email API service used by developers and businesses to send, receive, and track transactional and marketing emails.

San Antonio, TXmailgun.com

Maitland Orthopaedic & Rehab Specialists

Healthcare

Maitland Orthopaedic & Rehab Specialists is a medical clinic in East Maitland, New South Wales, providing orthopaedic surgery and musculoskeletal rehabilitation services through a group of specialist surgeons and clinicians.

East Maitland, New South Wales, Australiamaitland-orthopaedics-and-rehab-specialists.business.site

Makanai Ramen Noodle House

Restaurant

Makanai Ramen Noodle House is a Japanese restaurant in Castle Hill, NSW, specializing in ramen and other authentic Japanese dishes made from scratch with fresh ingredients.

Castle Hill, New South Wales, Australiamakanai.com.au

Make

Software

Make (formerly Integromat) is a visual automation and integration platform that lets users connect apps and services to build automated workflows without coding.

Prague, Czech Republicmake.com

Makoto Bento

Restaurant

Makoto Bento is a Japanese restaurant in Chatswood, Sydney, specializing in bento-style set meals, sushi, sashimi and other izakaya-style dishes, and is part of the Masuya International dining group.

Sydney, New South Wales, Australiamasuyainternational.com.au

Malibu Burgers

Fast Food

Malibu Burgers is a local fast-food burger restaurant in Ballina, New South Wales, offering a variety of gourmet-style burgers, chips, and related takeaway meals with vegetarian, vegan, and gluten-free options.

Ballina, New South Wales, Australiamalibuburgers.com.au

Maliga Ngura Services Ltd

Other

Maliga Ngura Services Ltd is an Aboriginal-owned social enterprise that provides integrated hospitality, catering, fleet, auxiliary, and professional cleaning services while creating employment and training opportunities grounded in culture and community on Darkinjung Country.

Mardi, New South Wales, Australia

Malolo Poke

Restaurant

Malolo Poke is a Hawaiian-inspired poke bowl eatery based in the Brisbane area, serving customizable bowls and signature combinations made with fresh seafood, meats, and salad ingredients.

Brisbane, Queensland, Australiamalolo.com.au

Maloney's Grocer

Grocery

Maloney's Grocer is an independent Australian grocery retailer operating premium neighbourhood supermarkets with a focus on fresh produce and gourmet food products.

Sydney, New South Wales, Australiamaloneysgrocer.com.au

Mana Coffee

Coffee

Mana Coffee is a campus café at Griffith University’s Mt Gravatt campus in Brisbane, offering specialty coffee alongside breakfast items, baked goods, and quick lunch options such as pies, sandwiches, burgers, and daily hot specials.

Brisbane, QLD, Australia

Manly Wharf Hotel

Bar

Manly Wharf Hotel is a waterfront pub and bar venue on Manly Wharf in Sydney, offering drinks, casual dining, and events with harbor views.

Manly, New South Wales, Australiamanlywharfhotel.com.au

Mann River Caravan Park

Travel

Mann River Caravan Park (also known as Mann River Caravan & Canoe Park) is a rural holiday park offering cabin and camping accommodation, canoeing and fishing activities, and on-site amenities including a service station, general store, takeaway food, bottle shop, and ice creamery on the Mann River at Jackadgery, New South Wales.

Jackadgery, New South Wales, Australiamannriver.com.au

Manning Aquatic Centre

Fitness

Manning Aquatic Centre is a public aquatic and leisure facility in Bathurst offering heated indoor and outdoor swimming pools, learn-to-swim programs, group fitness classes, spa, sauna and family recreation amenities.

Bathurst, New South Wales, Australiabathurstaquatic.com.au

Mannings

Pharmacy

Mannings is a health and beauty retail chain offering pharmacy services, personal care products, cosmetics, and household items, primarily in Hong Kong and Greater China.

Hong Kongmannings.com.hk

Mantra Hotels

Hotel

Mantra Hotels is an Australian hotel and apartment-style accommodation brand operating properties in key city, suburban, and leisure destinations, including Epping in Melbourne.

Issy-les-Moulineaux, Francemantra.com.au

Manychat

Software

Manychat is a marketing automation and chat platform that helps businesses create AI-powered chatbots and automated messaging flows across channels like Instagram, Facebook Messenger, WhatsApp, and SMS.

Austin, TXmanychat.com

Marae Izakaya

Restaurant

Marae Izakaya is a modern kaiseki-style Japanese restaurant and sushi train offering premium sashimi, sushi, yakiniku, and a curated selection of sake and beer, located in Chadstone Shopping Centre.

Chadstone, Victoria, Australiamaraeizakaya.com

Marano's Fuel

Gas Station

Marano's Fuel is an independent, locally owned fuel and lubricants distributor that operates a network of service stations and bulk fuel delivery services across North Queensland, Australia.

Miallo, Queensland, Australiamaranos.com.au

Marbecks Foodstore

Restaurant

Marbecks Foodstore is a café and gourmet food store in Dunedin’s Wall Street Mall, offering café-style meals, deli items, specialty groceries, and coffee made with local ingredients.

Dunedin, New Zealandmarbecks.co.nz

Marble Bar Roadhouse & Travellers Rest

Gas Station

Marble Bar Roadhouse & Travellers Rest is a combined roadhouse and motel in Marble Bar offering 24-hour fuel, groceries, takeaway meals, coffee, and basic accommodation for travelers in Western Australia’s Pilbara region.

Marble Bar, Western Australia, Australiafacebook.com

Marco Polo Kitchen

Restaurant

Marco Polo Kitchen is a Brisbane CBD café and corporate catering business serving specialty coffee, breakfast and lunch dishes, and office catering from its venue at No. 1 Anzac Square.

Brisbane City, Queensland, Australiamarcopolo.kitchen

Margaret River Brewhouse

Bar

Margaret River Brewhouse is a local microbrewery and brewpub in Margaret River, Western Australia, offering house-brewed craft beers alongside a full food menu in a relaxed, family‑friendly setting.

Margaret River, Western Australia, Australiamargaretriverbeer.co

Margarita Daze

Restaurant

Margarita Daze is a beachfront bar and casual dining restaurant in Umina Beach, New South Wales, offering cocktails, seafood, pizza, and modern pub-style dishes with live music and ocean views.

Umina Beach, New South Wales, Australiamargaritadaze.com.au

Mariam's Butchery Pty Ltd

Grocery

Mariam's Butchery Pty Ltd is a local halal butcher shop in Austral, New South Wales, offering fresh meat and poultry products to retail customers.

Austral, New South Wales, Australia

Mariolino's Italian Cuisine

Restaurant

Mariolino's Italian Cuisine is a small regional Italian restaurant group in western North Carolina, offering pasta, pizza, and classic Italian-American dishes in a casual, family-friendly setting.

Hayesville, North Carolina, United Statesmariolinosnc.com

Marius Street Investments

Restaurant

Marius Street Investments is an Australian private company that operated multiple hospitality venues, including restaurants, cafés and bars trading under names such as Ameno Italian Cuisine, Americana Sports Bar, Gelatoria Italia, and Red Door Cafe & Lounge Bar, likely servicing the Tamworth, New South Wales area.

Sydney, New South Wales, Australia

Mark Storay Cheaper Cars

Automotive

Mark Storay Cheaper Cars is a small used car dealership operating from 11 Pacific Avenue in Miami, Queensland, Australia, selling second‑hand vehicles.

Miami, Queensland, Australia

Mark's

Clothing

Mark's is a Canadian retail chain specializing in men's and women's casual, work, and industrial clothing and footwear.

Calgary, Alberta, Canadamarks.com

Market Place Newsagency

Retail

Independent newsagency and lottery outlet offering newspapers, magazines, cards, stationery, transport tickets, postage items, lottery products and small gifts, located within Pennant Hills Market Place shopping centre.

Pennant Hills, New South Wales, Australia

Marlston Enterprises Pty Ltd

Home & Garden

Marlston Enterprises Pty Ltd is the local Ford & Doonan Bunbury franchise, providing residential and commercial air-conditioning and refrigeration installation, servicing, and repairs in Western Australia’s South West region.

Bunbury, Western Australia, Australiafordanddoonansouthwest.com.au

Marrickville Aquarium

Pet

Local aquarium and pet fish retailer offering live freshwater fish and a range of aquarium equipment and supplies from its store in Marrickville, New South Wales.

Marrickville, NSW, Australia

Marrickville Metro Newsagency

Retail

Marrickville Metro Newsagency is a local newsagent and gift shop in the Marrickville Metro shopping centre, selling newspapers, magazines, lottery products, stationery, greeting cards, gifts and related items.

Marrickville, New South Wales, Australia

Marshalls

Retail

Marshalls is an off-price department store chain offering discounted brand-name and designer clothing, footwear, home goods, and accessories.

Framingham, MAmarshalls.com

Martha's Health Eatery

Restaurant

Likely a small, independent health‑focused café/restaurant trading as Martha's Health Eatery, serving lighter or "healthy" meals and drinks.

Sydney, New South Wales, Australia

Marwill

Home & Garden

Marwill Pty Ltd (trading as Marwill Mongrel Shop) is a local electrical and refrigeration contracting business in Julia Creek, Queensland, that operates a retail store selling hardware, camping and electrical goods, tyres, batteries, oils and general home and automotive supplies.

Julia Creek, Queensland, Australiamarwill.com.au

Massimo Dutti

Clothing

Massimo Dutti is an international fashion retailer offering contemporary clothing, footwear, and accessories for men and women, positioned in the premium segment of the Inditex group.

Arteixo, A Coruña, Spainmassimodutti.com

Master 7 Days Pty Ltd

Retail

Master 7 Days Pty Ltd is a Queensland-based Australian private company that appears to operate a small local retail or convenience-type business trading under the "Master 7 Days" name in the Gold Coast area.

Queensland, Australia

Master Rolls

Restaurant

Master Rolls is a Japanese and Asian-fusion restaurant in Baulkham Hills, Sydney, known for rice paper rolls, poke bowls, ramen, udon, and other casual Japanese dishes.

Baulkham Hills, New South Wales, Australiamasterrolls.com.au

Mataranka Roadhouse

Gas Station

Mataranka Roadhouse is a BP-branded roadhouse in Mataranka, Northern Territory, offering fuel, a general store with groceries and auto accessories, a bakery and restaurant, and on-site cabin accommodation for travelers.

Mataranka, Northern Territory, Australiamatarankaroadhouse.com.au

Mater

Healthcare

Mater is Queensland’s largest Catholic not‑for‑profit healthcare network, operating public and private hospitals along with research, education, pathology, pharmacy and community health services across the state.

Brisbane, Queensland, Australiamater.org.au

Matilda Bookshop

Retail

Matilda Bookshop is an independent bookstore in the Adelaide Hills specializing in new-release fiction, gardening, cooking, art and design, current affairs, biography, history, and children’s books, along with selected stationery and gifts.

Stirling, South Australia, Australiamatildabookshop.com.au

MattressNextDay

E-commerce

MattressNextDay is a UK-based online retailer specializing in mattresses, beds, and bedroom furniture, offering next-day delivery on many products.

Canterbury, England, United Kingdommattressnextday.co.uk

Matty & Johns Espresso Bar

Coffee

Matty & Johns Espresso Bar is a hole‑in‑the‑wall café in Camperdown, New South Wales, serving specialty coffee along with breakfast and lunch items on weekdays.

Camperdown, NSW, Australiageorgegregan.com

Max Displays

Retail

Max Displays is an Australian company that designs, manufactures, and sells retail branding materials, exhibition displays, banners, acrylic plinths, and other point-of-sale and trade show display products.

Glendenning, New South Wales, Australiamaxdisplays.com.au

MaxMind

Software

MaxMind is a privately held technology company that provides IP geolocation, proxy detection, and online fraud prevention tools such as its GeoIP and minFraud services to help businesses manage risk and enhance online security.

Malden, Massachusetts, United Statesmaxmind.com

MaxiPARTS

Automotive

MaxiPARTS is an Australian commercial truck and trailer parts retailer and distributor, supplying a wide range of parts, automotive supplies, and workshop consumables to transport and logistics operators.

Truganina, Victoria, Australiamaxiparts.com.au

Maxo Telecommunications

Telecom

Maxo Telecommunications (branded as MaxoTel) is an Australian provider of cloud-hosted business phone systems, VoIP, SIP trunking and related telephony services for businesses of all sizes.

Toowoomba, Queensland, Australiamaxo.com.au

Maxx Cut Barber

Personal Care

Maxx Cut Barber is a local barbershop offering men's haircuts and grooming services located in the Deepwater Plaza shopping centre in Woy Woy, New South Wales, Australia.

Woy Woy, New South Wales, Australia

McCauley's Bottleshop

Retail

McCauley's Bottleshop is an independent liquor retailer in Port Stephens, offering a wide range of beer, wine, spirits and related products, with drive-through, click-and-collect, and local delivery services.

Salamander Bay, New South Wales, Australiamccauley.net.au

McCoppins

Grocery

McCoppins is a family-owned, independent group of licensed supermarkets and boutique bottleshops in Melbourne, offering a curated range of gourmet foods, wines, beers, and spirits. The Fitzroy store operates primarily as a specialty wine and liquor shop with a strong focus on craft beer and quality beverages.

Melbourne, Victoria, Australiamccoppins.com.au

McCormicks Food Store

Fast Food

Local takeaway shop in Skye, Victoria offering fish and chips, burgers, HSPs and other fast-food style meals, with both in-store and delivery options.

240 McCormicks Rd, Skye, Victoria 3977, Australia

McDonald's

Fast Food

McDonald's is a global fast food restaurant chain known for hamburgers, chicken products, french fries, breakfast items, desserts, and beverages, operating tens of thousands of locations worldwide.

Chicago, Illinois, United Statesmcdonalds.com

McGarry's Irish Pub

Bar

McGarry's Irish Pub is a neighborhood Irish-style pub in Bakersfield, California, offering a full bar, pub food, and regular live music and events with a strong community and charitable focus.

Bakersfield, CAmcgarrysirishpub.com

Me Me Art

E-commerce

Me Me Art is an Australian online retailer specializing in wall art, custom framing, canvas printing, and art-hanging supplies for homes and small businesses.

Perth, Australiamemeart.com.au

Meat on Maitland

Grocery

Meat on Maitland is a family-owned butcher shop offering fresh, locally sourced meats and gourmet meat products, with stores in Bingara and Narrabri in north-west New South Wales, Australia.

Bingara, New South Wales, Australiameatonmaitland.com.au

Mecca Brands

Personal Care

Mecca Brands (commonly known as MECCA) is an Australian beauty retailer offering cosmetics, skincare, fragrance, and related beauty products through its MECCA stores and online platform.

Richmond, Victoria, Australiamecca.com

Mecca Cafe

Restaurant

Mecca Cafe was a local cafe/restaurant in Burnie, Tasmania, operated by Frenrad Pty Ltd under the registered business name “Mecca” and trading name “Mecca Cafe.”

Burnie, Tasmania, Australia

Mecca Coffee

Coffee

Mecca Coffee is an Australian specialty coffee company that imports, roasts, and serves high‑quality coffee through its roastery, cafes, and wholesale offerings.

Alexandria, New South Wales, Australiamecca.coffee

Medeor

Financial Services

Medeor is a healthcare-focused payment solutions provider that offers integrated EFTPOS and payment processing systems for medical practices, pharmacies, and other healthcare providers across Australia and New Zealand.

Auckland, New Zealandmedeorpayments.com.au

MediaMarkt

Electronics

MediaMarkt is a major European consumer electronics retailer offering a wide range of electronics, appliances, and related services through large-format stores and online shops.

Ingolstadt, Germanymediamarkt.nl

Medicongress Services

Other

Medicongress Services is a professional conference organizer (PCO) and association management company specializing in medical and scientific congresses and events worldwide.

Evergem (near Ghent), Belgiummedicongress.com

Medilux Media Solutions Limited

Other

Medilux Media Solutions Limited is a UK-based digital media and business support company that operates and manages online dating and related web platforms, as well as providing associated online services.

Wivenhoe, Colchester, Essex, United Kingdommediluxmediasolutions.com

Mega Office Supplies

E-commerce

Mega Office Supplies (trading as Mega Thing Pty Ltd) is an Australian online retailer of office supplies, business equipment, stationery and related products serving individuals, schools and businesses nationwide.

Tweed Heads South, NSW, Australiamegaofficesupplies.com.au

MegaBuy Technology Superstore

Electronics

MegaBuy Technology Superstore is an Australian online and bricks‑and‑mortar retailer of computers, components, and other IT and consumer electronics, operated by Megabuy Pty Ltd.

Lawnton, Queensland, Australiamegabuy.com.au

Melb Onstreet Parking

Transit

Likely a generic merchant descriptor used for on‑street parking meter payments in or around Melbourne, Australia, rather than a clearly branded private company.

Melbourne, Victoria, Australia

Melbourne Airport

Transit

Melbourne Airport is the primary international and domestic airport serving Melbourne, Australia, operated by Australia Pacific Airports (Melbourne) Pty Ltd.

Tullamarine, Victoria, Australiamelbourneairport.com.au

Melbourne City Chauffeur

Travel

Melbourne City Chauffeur is a private chauffeur and premium car service company offering airport transfers, corporate travel, event transport, weddings, and sightseeing tours in the Melbourne area.

Truganina, Victoria, Australiamelbournecitychauffeur.com.au

Melbourne City Council

Government

Melbourne City Council is the local government authority responsible for administering and providing municipal services, infrastructure, and regulations for the City of Melbourne, Australia.

Melbourne, Victoria, Australiamelbourne.vic.gov.au

Melbourne Convention and Exhibition Centre

Entertainment

Melbourne Convention and Exhibition Centre (MCEC) is a major convention and events venue in Melbourne, hosting exhibitions, conferences, trade shows, concerts and large-scale public events.

South Wharf, Melbourne, Victoria, Australiamcec.com.au

Melbourne IT

Software

Melbourne IT is an Australian domain name registrar and web services provider offering domain registrations, web hosting, email, and related online business solutions.

Brisbane, QLD, Australiamelbourneit.com.au

Melton City Council

Government

Melton City Council is the local government authority responsible for providing municipal services, planning, and community facilities for the City of Melton in Victoria, Australia.

Melton, Victoria, Australiamelton.vic.gov.au

Meninya Street Pharmacy

Pharmacy

Meninya Street Pharmacy is a community pharmacy in Moama, New South Wales, providing prescription medications, health advice, and medication management services as part of the Moama Pharmacy group alongside Moama Village Pharmacy.

Moama, New South Wales, Australiamoamapharmacy.com.au

Menulog

Delivery

Menulog is an online food delivery platform and marketplace that connects customers with local restaurants for takeaway and delivery orders across Australia and New Zealand.

Sydney, Australiamenulog.com.au

Mercure

Hotel

Mercure is a midscale hotel brand offering business and leisure accommodations with locally inspired design and services, operated as part of the Accor hotel group.

Issy-les-Moulineaux, Francemercure.com

Mercury Creative

Other

Mercury Creative is an independent Australian print and design company offering custom graphic design, digital and offset printing, signage, point-of-sale displays, branded whiteboards, and other promotional materials for businesses and events.

Belrose, New South Wales, Australiamercurycreative.com.au

Meriton Suites

Hotel

Meriton Suites is an Australian serviced apartment and hotel operator offering extended-stay and short-stay accommodation in major cities, particularly Sydney. It is part of the broader Meriton property and development group.

Sydney, New South Wales, Australiameritonsuites.com.au

Merivale

Restaurant

Merivale is an Australian hospitality group that owns and operates a large portfolio of restaurants, bars, pubs, nightlife venues, and event spaces, primarily in Sydney. It offers dining, drinks, and entertainment experiences across numerous branded venues.

Sydney, New South Wales, Australiamerivale.com

MessageMedia

Software

MessageMedia is a cloud-based business messaging provider that offers SMS, MMS, and mobile communication solutions for customer engagement, alerts, and marketing campaigns.

Melbourne, Australiamessagemedia.com

Meta

Software

Meta is a multinational technology company that owns Facebook, Instagram, WhatsApp and other platforms, and operates a digital advertising network where businesses buy and run ads across its apps. This card descriptor refers specifically to Meta’s online advertising charges processed via its Facebook/Meta Ads platform, often billed from Ireland.

Menlo Park, California, United Statesmeta.com

Meta Ads

E-commerce

Meta Ads is the online advertising platform of Meta Platforms that serves paid ads across Facebook, Instagram, Messenger, and other Meta properties.

Menlo Park, California, United Statesmeta.com

Meta Pay

Financial Services

Meta Pay is Meta’s digital payments service that lets people shop, send and receive money, and donate across Facebook, Instagram, WhatsApp, Messenger, and supported websites using stored payment methods.

Menlo Park, CA, USAmeta.com

Meta Platforms

Other

Meta Platforms is a technology company that operates social networking and communication services including Facebook, Instagram, WhatsApp, and the Meta advertising platform, which processes charges for Facebook and Instagram ads.

Menlo Park, California, USAmeta.com

Metcash

Grocery

Metcash Limited is an Australian wholesale distribution and marketing company that supplies independent supermarkets, convenience stores, liquor retailers, and hardware stores across Australia.

Macquarie Park, New South Wales, Australiametcash.com

Metro Petroleum

Gas Station

Metro Petroleum is an Australian chain of independent service stations offering fuel, lubricants, and convenience-store items.

Sydney, Australiametropetroleum.com.au

Metro South Health

Healthcare

Metro South Health is a Queensland Government hospital and health service that provides public healthcare, education, and research across Brisbane’s south side, Logan, Redlands and Scenic Rim regions, operating major facilities including Logan Hospital and Meadowbrook Health Centre.

Brisbane, Queensland, Australiametrosouth.health.qld.gov.au

Metro Trains Melbourne

Transit

Metro Trains Melbourne is the franchised operator of Melbourne’s electrified suburban rail network, running metropolitan passenger train services across the city’s 16 lines and maintaining associated rolling stock and rail infrastructure.

Melbourne, Victoria, Australiametrotrains.com.au

Metro Trains Sydney

Transit

Metro Trains Sydney (MTS) is the private operator and maintainer of Sydney Metro’s M1 Northwest and Bankstown Line, Australia’s fully accessible, driverless metro rail service.

Sydney, New South Wales, Australiametrotrains-sydney.com.au

Metropolitan Transportation Authority

Transit

The Metropolitan Transportation Authority (MTA) operates New York City’s subways, buses, commuter railroads, and related public transportation services. The "NYCT PAYGO" descriptor refers to pay-as-you-go fares for MTA New York City Transit services.

New York, NYmta.info

Mezes Espresso Bar Restaurant

Restaurant

Mezes Espresso Bar Restaurant is a Greek and Mediterranean-style café and restaurant offering breakfast, coffee, and full lunch and dinner menus in Brighton-Le-Sands, Sydney.

Brighton-Le-Sands, New South Wales, Australiamezes.com.au

Microsoft

Software

Microsoft is a global technology company that develops and sells computer software, consumer electronics, personal computers, and related services, including subscriptions such as Microsoft 365 and Xbox services. The msbill.info reference indicates a Microsoft billing or subscription charge.

Redmond, WAmicrosoft.com

Microsoft 365

Software

Microsoft 365 is a subscription-based suite of productivity and collaboration software and cloud services offered by Microsoft, including apps like Word, Excel, PowerPoint, Outlook, and OneDrive.

Redmond, WAmicrosoft.com

Microsoft Advertising

Software

Microsoft Advertising is Microsoft’s online advertising platform that provides pay-per-click search, display, and native advertising across Bing, partner sites, and the Microsoft ecosystem.

Redmond, WA, USAadvertising.microsoft.com

Microsoft Store

Software

Microsoft Store is Microsoft's official retail and online store for purchasing software, subscriptions, games, and Microsoft-branded hardware and devices.

Redmond, WAmicrosoft.com/store

Middle Park Bowling Club

Entertainment

Middle Park Bowling Club is a lawn bowls and social club offering barefoot bowls, competitive pennant bowls, a bar, bistro-style food, and function/event hosting in Melbourne’s Albert Park/Middle Park area.

Middle Park, Victoria, Australiamiddleparkbowls.com.au

Midjourney

Software

Midjourney is an independent research lab that develops an AI-powered image generation platform, allowing users to create images from text prompts, typically accessed via Discord and the web.

San Francisco, CAmidjourney.com

Migros

Grocery

Migros is a major Turkish supermarket chain offering groceries, household goods, and everyday consumer products through various store formats across Turkey.

Istanbul, Turkeymigros.com.tr

Mildren & Coysh Pty Ltd

Automotive

Mildren & Coysh Pty Ltd is a family-owned automotive service centre in Corryong, Victoria, providing mechanical and auto-electrical repairs, towing, roadside assistance, fuel, pumps, rural/industrial supplies, and CFMoto sales and service.

Corryong, Victoria, Australiamildrenandcoysh.com.au

MilesWeb

Software

MilesWeb is an Indian web hosting company that provides shared, VPS, reseller, dedicated and cloud hosting, as well as domain registration and related online infrastructure services to customers worldwide.

Nashik, Maharashtra, Indiamilesweb.com

Milikapiti Community Store

Grocery

A small community-owned supermarket in the remote Tiwi community of Milikapiti, supplying groceries, fresh fruit and vegetables, meat, power and phone cards, and basic hardware and camping goods to local residents.

Milikapiti, Melville Island, Northern Territory, Australia

Milkrun

Delivery

Milkrun is an Australian rapid grocery and alcohol delivery service that allows customers to order supermarket items via an app or website for fast home delivery, and is operated as part of Woolworths Group’s express delivery offering.

Sydney, New South Wales, Australiamilkrun.com

Minh Lam Pty Ltd

Other

Minh Lam Pty Ltd is an Australian private proprietary company registered in 2017; publicly available records do not clearly indicate its specific industry or consumer-facing brand, suggesting it may operate as a small or private business entity rather than a well-known retail brand.

VIC 3023, Australia

Minuteman

Other

Minuteman is a locally owned New Zealand locksmith and repair business offering key cutting, mobile locksmith services, shoe repairs, engraving, security alarms, safes, and related services across Tauranga and the Bay of Plenty region.

Tauranga, Bay of Plenty, New Zealandminuteman.co.nz

Miracom

Telecom

Miracom is an Australian telecommunications provider offering broadband internet, VoIP, and phone services to residential and business customers.

Canterbury, Victoria, Australiamiracom.com.au

Miro

Software

Miro is an online collaborative whiteboard and visual workspace platform used for product planning, brainstorming, workshops, and remote collaboration.

San Francisco, CAmiro.com

Miss Frank Cafe

Coffee

Miss Frank Cafe is a local Camberwell café serving specialty coffee alongside breakfast, brunch, and lunch dishes in a relaxed, family‑friendly setting.

Camberwell, Victoria, Australiamissfrankcafe.com

Miss Maud

Restaurant

Miss Maud is a Western Australian hospitality group operating Swedish-themed pastry houses, cafés, restaurants, and catering services, as well as a boutique hotel in Perth.

Perth, Western Australia, Australiamissmaud.com.au

Mission Cafe

Coffee

Mission Cafe is a Sydney CBD café offering specialty coffee, tea, and a menu focused on organic, sustainable and healthy breakfast and lunch options, alongside in‑house catering services.

Sydney, NSW, Australiamissioncatering.com.au

Mister Bartender

Bar

Mister Bartender is an Australian mobile bar and cocktail catering business that provides luxury bar hire, bartending services, and bottled ready-to-drink cocktails and mocktails for events and home consumption.

Melbourne, Victoria, Australiamisterbartender.com.au

Mister Bean Espresso

Coffee

Mister Bean Espresso is a family-run café in Fortitude Valley serving specialty coffee and a simple menu of freshly made breakfast and lunch dishes.

Brisbane, Queensland, Australiafacebook.com

Mister Minh

Restaurant

Mister Minh is a Vietnamese restaurant and bar offering traditional and modern Vietnamese dishes, cocktails, and event catering from its single location in Richmond, Victoria.

Richmond, Victoria, Australiamisterminh.com.au

Mister Minit

Other

Mister Minit is an international chain of service shops offering shoe repair and care, key cutting, engraving, watch repairs, and related personal item repair services, with locations in shopping centres worldwide including New Zealand.

Brussels, Belgiummisterminit.co

Mister Sushi

Restaurant

Mister Sushi is a local Japanese restaurant in St Ives, New South Wales, offering freshly made sushi, sashimi, bento boxes and other casual Japanese dishes for dine‑in, takeaway and delivery.

St Ives, New South Wales, Australia

Mitre 10

Home & Garden

Mitre 10 is an Australian hardware and home improvement retail chain operating as a network of independently owned stores, offering tools, building supplies, paint, garden products, and household hardware. This descriptor specifically corresponds to the Byron Bay Mitre 10 store at 148 Jonson Street, Byron Bay, NSW.

Heatherton, Victoria, Australiamitre10.com.au

Mitre Tavern

Bar

Mitre Tavern is a historic English-style pub and steakhouse in Melbourne’s CBD, known for its large beer garden, extensive selection of beers, and classic pub meals including steaks and burgers.

Camberwell, Victoria, Australiamitretavern.com.au

Mivy Group Pty Ltd

Other

Mivy Group Pty Ltd is an Australian proprietary limited company registered in New South Wales; its specific line of business is not clearly disclosed in public sources and it appears primarily as a legal entity in corporate and credit registers.

North Sydney, NSW, Australia

Mixmax

Software

Mixmax is a software-as-a-service sales engagement and AI-powered sales execution platform that enhances email, scheduling, and workflow automation for revenue teams, primarily through Gmail and CRM integrations.

San Francisco, CAmixmax.com

Mixt Kitchen

Restaurant

Mixt Kitchen is a local cafe-style eatery in Yarrawonga, Victoria, serving casual meals and coffee, and acting as a stockist for local Australian products such as Fly High Chai.

Yarrawonga, Victoria, Australia

Mobike

Transit

Mobike is a Chinese dockless bike-sharing service that provides app-based short-distance transportation using GPS-enabled bicycles and e-bikes in urban areas.

Beijing, Chinamobike.com

Mobil

Gas Station

Mobil is a global petroleum brand used for service stations and related fuel and lubricant products, primarily operated by ExxonMobil and its licensees.

Irving, TXmobil.com

Moco151

Restaurant

Moco151 is a local café-restaurant in Como, Western Australia, serving breakfast and lunch with a fusion of Vietnamese and Australian dishes alongside specialty coffee.

Como, Western Australia, Australiafacebook.com

Modern Health

Healthcare

Modern Health is a global workplace mental health platform that provides employees with access to digital tools, coaching, and licensed therapists to support emotional and overall well-being.

San Francisco, CAmodernhealth.com

Modern Teaching Aids

Education

Modern Teaching Aids is an Australian supplier of educational resources and classroom materials for early childhood centres, schools, and other learning institutions.

Kings Park, New South Wales, Australiateaching.com.au

Mojang Studios

Gaming

Mojang Studios is a Swedish video game developer best known for creating the sandbox game Minecraft and related titles and services.

Stockholm, Swedenmojang.com

Mojo Coffee

Coffee

Mojo Coffee is a New Zealand specialty coffee roaster and café operator founded in 2003, running a network of branded cafés and supplying roasted coffee to retail and wholesale customers.

Wellington, New Zealandmojo.coffee

Mojo Record Bar

Bar

Mojo Record Bar is a combined underground cocktail bar and vinyl record store in central Sydney, offering drinks, DJ sets, and new and used records for sale.

Sydney, Australiamojorecordbar.com

Molly

Bar

Molly is a 1920s-inspired speakeasy-style cocktail and whisky bar in central Canberra, known for its extensive whisky selection, craft cocktails, and regular live jazz performances.

Canberra, ACT, Australiamolly.bar

Monetan Nominees

Entertainment

Monetan Nominees is a registered business name used by The Men's Gallery, a Melbourne-based gentlemen's club and adult entertainment venue offering strip shows, private dances and event hosting.

Melbourne, Victoria, Australiamensgallery.com.au

Moneypenny

Telecom

Moneypenny provides outsourced receptionist, telephone answering, and live chat services for businesses, handling inbound calls and messages on their behalf.

Wrexham, Wales, United Kingdommoneypenny.com

Monkey House Cafe

Coffee

Monkey House Cafe is a local café in Strathfield, New South Wales, serving specialty coffee, burgers, sandwiches and light café meals in a casual setting near Strathfield railway station.

Strathfield, New South Wales, Australiainstagram.com/monkeyhouse.strathfield

Monocraft Embroidery

Clothing

Monocraft Embroidery is a South Australian contract embroidery company supplying the promotions industry and garment and schoolwear manufacturers with logo embroidery, applique, and embossing services since 1989.

Mansfield Park, South Australia, Australiamonocraft.com.au

Moo Moo The Wine Bar + Grill

Restaurant

Moo Moo The Wine Bar + Grill is an upscale Australian steakhouse and wine bar known for premium beef, extensive wine lists, and modern fine-dining venues in Brisbane and on the Gold Coast.

Brisbane, Queensland, Australiamoomoorestaurant.com

Moonee Ponds Keys Plus

Retail

Moonee Ponds Keys Plus is a local key duplication and locksmith shop in Moonee Ponds offering key cutting, car key services, lock repairs, and related security products.

Moonee Ponds, Victoria, Australiayes-we-do-repair-keys.business.site

Moonton

Gaming

Moonton is a Chinese video game developer and publisher best known for the mobile MOBA game Mobile Legends: Bang Bang and other mobile titles, with in‑app purchases commonly billed through Google Play under the legacy name YoungJoy Technology Limited.

Minhang District, Shanghai, Chinaen.moonton.com

Morley Fresh

Grocery

Morley Fresh is a local fruit and vegetable shop/greengrocer located in the Galleria Shopping Centre in Morley, Western Australia, offering fresh produce and related grocery items.

Morley, Western Australia, Australia

Motion

Software

Motion is a productivity and scheduling software platform that uses AI to automatically plan calendars, manage tasks, and organize work for individuals and teams.

San Francisco, CAusemotion.com

Motion Design School

Education

Motion Design School is an online education platform offering courses, masterclasses, and tools for motion design, 2D and 3D animation, and related creative disciplines.

New York, NY, United Statesmotiondesign.school

Motor Vehicle Registry

Government

The Motor Vehicle Registry (MVR) is a Northern Territory Government agency that manages vehicle registration, driver licensing, and related transport services across the Northern Territory of Australia.

Darwin, Northern Territory, Australiant.gov.au

Mount Street Terrace Hotel

Bar

Mount Street Terrace Hotel is a pub and bar in North Sydney offering drinks, casual bistro-style food, and gaming facilities, popular with local workers and visitors.

North Sydney, New South Wales, Australiamountstreetterrace.com

Mounties Group

Entertainment

Mounties Group is an Australian profit-for-purpose hospitality and entertainment organisation that operates a portfolio of registered clubs, bars, restaurants, gaming, health and fitness, and leisure venues across South-West Sydney, the Northern Beaches and the Central Coast. It focuses on providing community-oriented entertainment, food and beverage, and recreational facilities for its members and guests.

Mt Pritchard, New South Wales, Australiamountiesgroup.com.au

Mouser Electronics

Electronics

Mouser Electronics is a global distributor of electronic components and semiconductors, supplying engineers and designers with a wide range of products from leading manufacturers.

Mansfield, TXmouser.com

Move Yourself Trailer Hire

Automotive

Move Yourself Trailer Hire is an Australian self-move vehicle and trailer rental company offering trailers, utes, trucks, and other equipment for short- and long-term hire.

Cavan, South Australia, Australiamoveyourself.com.au

Mr Ashcroft

Coffee

Mr Ashcroft is a gourmet café and catering company located on Little Collins Street in Melbourne’s CBD, serving specialty coffee and ready-to-go meals, sandwiches, and pastries. The venue was formerly branded as “Lt. Colin” or “Little Colin” before being renamed and repositioned as Mr Ashcroft.

Melbourne, Victoria, Australiamrashcroft.com.au

Mr Cappuccino

Coffee

Mr Cappuccino is a Canberra-based coffee and catering company operating espresso bars and cafés in government and commercial buildings and providing corporate catering services across the Canberra region.

Fyshwick, ACT, Australiamrcap.com.au

Mr Crackles

Restaurant

Mr Crackles is a Sydney-based eatery known for its crispy roast pork, pork belly rolls, and other casual street-food-style dishes.

Sydney, NSW, Australiamrcrackles.com.au

Mr Edward's Alehouse & Kitchen

Bar

Mr Edward's Alehouse & Kitchen is a Brisbane CBD gastropub and bar offering European-influenced modern Australian food, craft beer, wine, and cocktails in a relaxed indoor and outdoor setting.

Brisbane City, Queensland, Australiamredwardsalehouse.com.au

Mr Green & Co

Coffee

Mr Green & Co is a local café in North Sydney offering espresso coffee, tea, and light café food such as brunch items and snacks.

North Sydney, NSW, Australia

Mrs Higgins

Restaurant

Mrs Higgins is a New Zealand cookie brand and bakery chain that produces and sells soft, oven-fresh cookies, brownies, slices and other baked treats through retail stores and wholesale channels.

Henderson, Auckland, New Zealandmrshiggins.com

Mrs. Fields

Restaurant

Mrs. Fields is an international chain of bakeries known for its cookies, brownies, and related baked goods, often operating as small café-style outlets in malls and airports.

Broomfield, COmrsfields.com

Mudgee Radio Cabs

Transit

Mudgee Radio Cabs is a local taxi company providing 24/7 cab and maxi taxi services in and around Mudgee, New South Wales.

Mudgee, New South Wales, Australiamudgee-radio-cabs.business.site

Muffin Break

Coffee

Muffin Break is an international bakery café franchise serving freshly baked muffins, light meals, and specialty coffee, primarily located in shopping centres across Australia, New Zealand, and the United Kingdom.

Sydney, New South Wales, Australiamuffinbreak.com.au

Mughouse Cafe

Coffee

Mughouse Cafe is a local café and coffee shop on Collins Street in central Melbourne serving espresso drinks, breakfast plates, light meals, and fresh juices to nearby office workers and city visitors.

Melbourne, Victoria, Australia

Mulga Creek Hotel

Hotel

Mulga Creek Hotel is a historic outback pub in Byrock, New South Wales, offering a bar, bistro-style meals, motel rooms, and caravan and camping facilities in a classic bush setting.

Byrock, New South Wales, Australiafacebook.com/MulgaCreekHotel

MultiTracks.com

Software

MultiTracks.com provides digital worship resources for churches and musicians, including multitracks, rehearsal tools, and software/apps for live performance and worship services.

Cedar Park, TXmultitracks.com

Murchison Jandamarra Groceries

Grocery

Murchison Jandamarra Groceries is an Australian grocery and packaged liquor retailer that operates a local supermarket and bottle shop in Mount Magnet, Western Australia, trading under names such as Gekkos Mount Magnet and Mt Magnet IGA Plus Liquor.

Applecross, Western Australia, Australia

Murder Mystery Fun

Entertainment

Murder Mystery Fun is an Australian company that produces and hosts interactive murder mystery events for parties, corporate functions, and virtual gatherings, using professional actors and role-play games to entertain guests.

Sydney, NSW, Australiamurdermysteryfun.com.au

Mures Lower Deck

Restaurant

Mures Lower Deck is a casual, family-friendly seafood bistro, café, and fishmonger on Hobart’s waterfront, serving hook‑to‑plate Tasmanian seafood, fish and chips, and ice cream.

Hobart, Tasmania, Australiamures.com.au

Murrays Australia Limited

Transit

Murrays Australia Limited, trading as Murrays Coaches, is a private Australian coach operator providing intercity coach services, charter services, and tour transport across eastern Australia.

Sydney, New South Wales, Australiamurrays.com.au

Murrinhpatha Nimmipa Store

Grocery

Murrinhpatha Nimmipa Store is a community-owned supermarket and general store providing groceries, household goods and everyday essentials to residents of the remote Aboriginal community of Wadeye (Port Keats) in the Northern Territory of Australia.

Wadeye, Northern Territory, Australia

Murrumbateman Country Inn

Hotel

Murrumbateman Country Inn is a country pub and inn offering motel-style accommodation, a bistro, and the Shearing Shed Bar in the heart of the Murrumbateman wine region in New South Wales, Australia.

Murrumbateman, New South Wales, Australiamurrumbatemaninn.com.au

Museum of Contemporary Art

Entertainment

The Museum of Contemporary Art Australia (MCA) is a major public gallery dedicated to exhibiting, collecting, and interpreting contemporary art, located in The Rocks on Sydney Harbour.

Sydney, Australiamca.com.au

Museums Victoria

Entertainment

Museums Victoria is the organization that manages several major public museums in Victoria, Australia, including Melbourne Museum, Immigration Museum, and Scienceworks.

Melbourne, Victoria, Australiamuseumsvictoria.com.au

Mustafa's Kebab House

Restaurant

Local Middle Eastern kebab shop and café serving kebabs, grilled meats, rice plates, dips, nuts, sweets, and ice cream from locations in the Hunter Region of New South Wales, including Raymond Terrace Marketplace.

Maitland, New South Wales, Australia

Muzz Buzz

Coffee

Muzz Buzz is an Australian drive-through coffee chain offering espresso-based drinks, cold beverages, and light snacks.

Perth, Western Australia, Australiamuzzbuzz.com

Mwave

Electronics

Mwave is an Australian online retailer specializing in computer hardware, consumer electronics, gaming gear, and IT components, operating both online and from a warehouse/store in Lidcombe, New South Wales.

Lidcombe, New South Wales, Australiamwave.com.au

My BBQ

Restaurant

My BBQ is a Chinese restaurant offering roast meats, barbecued dishes, and other Cantonese-style meals, operating from the Stockland Glendale shopping centre in New South Wales, Australia.

Glendale, New South Wales, Australiamy-bbq.com.au

My Chemist

Pharmacy

My Chemist is an Australian retail pharmacy chain offering prescription medications, over-the-counter medicines, health products, and personal care items. It operates as part of the wider Chemist Warehouse/My Chemist pharmacy group.

Melbourne, Victoria, Australiamychemist.com.au

My Choice

Retail

Local retail shop trading under the name "My Choice" at 92 Parramatta Road in Lidcombe, New South Wales, offering general shop/variety retail goods.

Lidcombe, NSW, Australia

My Family Planner

Retail

My Family Planner is an Australian, family-owned online store that sells magnetic planners, calendars, and organisational tools designed to help families manage weekly, monthly, and meal planning at home.

Australiamyfamilyweeklyplanner.com.au

My Fast Ferry

Transit

My Fast Ferry operates high-speed passenger ferry services on Sydney Harbour, including routes between Circular Quay and Manly.

Sydney, New South Wales, Australiamyfastferry.com.au

My Grandma Ben

Restaurant

My Grandma Ben is a sustainably focused café, bar, and workshop space in Bowden, South Australia, offering a seasonal, largely vegetarian menu alongside pickling, preserving and fermenting workshops with a strong zero‑waste ethos.

Bowden, South Australia, Australiamygrandmaben.com

My Taxi

Rideshare

Small independent taxi service operating around Lakemba, Australia, providing local point‑to‑point transportation by phone booking.

Lakemba, New South Wales, Australia

MyAssays

Software

MyAssays is a UK-based software company providing cloud and desktop tools for analysis of life sciences assay data, including ELISA and other bioassays, with integrations for Excel and lab instrumentation.

Brighton, East Sussex, United Kingdommyassays.com

MyDeal

E-commerce

MyDeal is an Australian online marketplace offering a wide range of products including furniture, homewares, electronics, and everyday items from various third-party sellers.

Melbourne, Australiamydeal.com.au

MyEvent Productions

Entertainment

MyEvent Productions is an Australian live events and audio-visual production company that provides end-to-end AV solutions, live production, and professional live streaming and video hosting services for corporate and other events.

Melbourne, Victoria, Australiamyevent.io

MyFlag

E-commerce

MyFlag is an Australian online retailer specializing in national, state, novelty, and custom-style flags, bunting, and related accessories for individuals, schools, and businesses.

Brisbane, QLD, Australiamyflag.com.au

MyFriendAI

Software

MyFriendAI is a subscription-based AI assistant service that provides users with a personal chatbot to help with tasks such as reminders, scheduling, and other day‑to‑day support.

India (exact headquarters city not publicly disclosed)myfriendai.com

MyPost Business

Delivery

MyPost Business is Australia Post’s business-focused shipping and mailing service, offering discounted parcel delivery, tracking, and logistics tools for small and medium-sized businesses.

Melbourne, Victoria, Australiaauspost.com.au

MyRepublic

Telecom

MyRepublic is a telecommunications company that provides broadband, mobile, and related internet services, primarily in the Asia-Pacific region.

Singaporemyrepublic.net

Myer

Retail

Myer is a major Australian department store chain offering fashion, beauty, homewares, electrical goods, toys, and general merchandise both in-store and online.

Docklands, Victoria, Australiamyer.com.au

Myer Centre Adelaide

Retail

Myer Centre Adelaide is a multi-level shopping centre in Adelaide’s Rundle Mall, featuring South Australia’s largest Myer department store along with dozens of specialty retailers, services, and a large food court.

Adelaide, South Australia, Australiamyercentreadelaide.com.au

Mykitchen Cafe Pty Ltd

Restaurant

Mykitchen Cafe Pty Ltd is an independently owned café/restaurant operating in the Lidcombe/Berala area of New South Wales, Australia, likely serving casual meals, snacks and drinks under its own local brand.

Lidcombe, New South Wales, Australia

Müller

Retail

Müller is a large European retail and drugstore chain offering a wide assortment of health and beauty products, household goods, toys, stationery, multimedia, and more.

Ulm, Germanymueller.de

Münchner Stubn

Restaurant

Münchner Stubn is a Bavarian restaurant and inn located by Munich Central Station, serving traditional regional dishes and beer in a rustic, contemporary setting.

Munich, Germanymuenchner-stubn.de

me&u

Software

me&u is a hospitality technology platform that lets guests order and pay for food and drinks via QR codes and mobile devices, while providing venues with AI-driven menus, marketing tools, and guest data to increase revenue and improve service.

Surry Hills, New South Wales, Australiameandu.com

monday.com

Software

monday.com is a cloud-based work operating system and project management platform that helps teams plan, track, and manage tasks, workflows, and collaboration.

Tel Aviv, Israelmonday.com

myCaseCovers

E-commerce

myCaseCovers is an Australian online retailer operated by Lexine Pty Ltd, specializing in mobile phone and tablet cases, covers, and related accessories for brands like Apple and Samsung.

Chatswood, New South Wales, Australiamycasecovers.com.au

mycause

Charity

mycause is an Australian online fundraising and crowdfunding platform that enables individuals, charities, and organizations to collect donations for causes and campaigns.

Melbourne, Victoria, Australiamycause.com.au

myki

Transit

myki is a reloadable contactless smartcard ticketing system used to pay fares on most public transport services in Melbourne and regional Victoria, Australia, including trains, trams and buses.

Melbourne, Victoria, Australiaptv.vic.gov.au